| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1499 |
Name | CTNNB1 |
Synonym | CTNNB|MRD19|armadillo;catenin (cadherin-associated protein), beta 1, 88kDa;CTNNB1;catenin (cadherin-associated protein), beta 1, 88kDa |
Definition | catenin beta-1 |
Position | 3p21 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "We observed linkage evidence in four regions: 3q22 ([median log of the odds (LOD) = 3.43]), 3p12 (median LOD) = 2.35), 2p22 (median LOD = 2.21), and 13q21 (median LOD = 2.09). When used in conjunction with the non-parametric bootstrap, our approach yields high-resolution to identify candidate gene regions containing putative BMPR2-interacting genes. Imputation of the disease model by LOD-score maximization indicates that the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically." |
| More detail of all Human literatures about CTNNB1 | |
|
Pathways and Diseases |
|
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | Cell junction organization;Reactome;REACT:20676 |
Pathway | Presenilin action in Notch and Wnt signaling;PID Curated;200052 |
Pathway | multi-step regulation of transcription by pitx2;PID BioCarta;100074 |
Pathway | Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161 |
Pathway | Endometrial cancer;KEGG PATHWAY;hsa05213 |
Pathway | N-cadherin signaling events;PID Curated;200180 |
Pathway | Basal cell carcinoma;KEGG PATHWAY;hsa05217 |
Pathway | Beta-catenin phosphorylation cascade;PID Reactome;500311 |
Pathway | segmentation clock;PID BioCarta;100146 |
Pathway | Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032 |
Pathway | trefoil factors initiate mucosal healing;PID BioCarta;100018 |
Pathway | Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100 |
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | Melanogenesis;KEGG PATHWAY;hsa04916 |
Pathway | inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | TGF-beta receptor signaling;PID Curated;200195 |
Pathway | Signaling by Wnt;Reactome;REACT:11045 |
Pathway | Nectin adhesion pathway;PID Curated;200053 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | cell to cell adhesion signaling;PID BioCarta;100208 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | CDC42 signaling events;PID Curated;200057 |
Pathway | Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130 |
Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | FoxO family signaling;PID Curated;200091 |
Pathway | Adherens junction;KEGG PATHWAY;hsa04520 |
Pathway | wnt signaling pathway;PID BioCarta;100002 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | Cadherin signaling pathway;PANTHER;P00012 |
Pathway | E-cadherin signaling events;PID Curated;200094 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Angiogenesis;PANTHER;P00005 |
Pathway | E-cadherin signaling in the nascent adherens junction;PID Curated;200105 |
Pathway | Myogenesis;Reactome;REACT:21303 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Thyroid cancer;KEGG PATHWAY;hsa05216 |
Pathway | Canonical Wnt signaling pathway;PID Curated;200064 |
Pathway | Degradation of beta-catenin by the destruction complex;PID Reactome;500310 |
Pathway | Alzheimer disease-presenilin pathway;PANTHER;P00004 |
Pathway | Arf6 trafficking events;PID Curated;200046 |
Pathway | Tight junction;KEGG PATHWAY;hsa04530 |
Pathway | RAC1 signaling pathway;PID Curated;200190 |
Pathway | p53 pathway feedback loops 2;PANTHER;P04398 |
Pathway | Coregulation of Androgen receptor activity;PID Curated;200038 |
Pathway | Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155 |
Pathway | Apoptotic cleavage of cell adhesion proteins;PID Reactome;500272 |
Disease | Colorectal cancer;KEGG DISEASE;H00020 |
Disease | Thyroid cancer;KEGG DISEASE;H00032 |
Disease | Gastric cancer;KEGG DISEASE;H00018 |
Disease | Aseptic necrosis of bone;FunDO |
Disease | Colorectal cancer;OMIM |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | Uterine disease;FunDO |
Disease | Depression;FunDO |
Disease | high exposure to aflatoxin B1.;GAD |
Disease | Ulcerative colitis;FunDO |
Disease | Bone mineral density (hip);GAD |
Disease | Dermatitis;FunDO |
Disease | Systemic scleroderma;FunDO |
Disease | Cancers of endocrine organs;KEGG DISEASE |
Disease | METABOLIC;GAD |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | Alzheimer's disease;FunDO |
Disease | Hepatocellular carcinoma;OMIM |
Disease | Hepatocellular carcinoma;KEGG DISEASE;H00048 |
Disease | CANCER;GAD |
Disease | Endometrial cancer;KEGG DISEASE;H00026 |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Endometriosis;FunDO |
Disease | Bone mineral density (hip);NHGRI |
Disease | Cancers;KEGG DISEASE |
Disease | Hepatoblastoma;OMIM |
Disease | Congenital abnormality;FunDO |
Disease | Ovarian cancer;OMIM |
Disease | Pilomatricoma;OMIM |
|
External Links |
|
Links to Entrez Gene | 1499 |
Links to all GeneRIF Items | 1499 |
Links to iHOP | 1499 |
|
Sequence Information |
|
Nucleotide Sequence |
>1499 : length: 2346 atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct gagacattagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta aatgacgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac ctttcccatcatcgtgagggcttactggccatctttaagtctggaggcattcctgccctg gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc cttcaaattttagcttatggcaaccaagaaagcaagctcatcatactggctagtggtgga ccccaagctttagtaaatataatgaggacctatacttacgaaaaactactgtggaccaca agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg gcccagaatgcagttcgccttcactatggactaccagttgtggttaagctcttacaccca ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt cccgcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt gtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatccta gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg acagagttacttcactctaggaatgaaggtgtggcgacatatgcagctgctgttttgttc cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac ctgtaa |
Protein Sequence |
>1499 : length: 781 MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD L |