|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1030 |
Name | CDKN2B |
Synonym | CDK4I|INK4B|MTS2|P15|TP15|p15INK4b;cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4);CDKN2B;cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) |
Definition | CDK inhibitory protein|CDK4B inhibitor|MTS-2|cyclin-dependent kinase 4 inhibitor B|cyclin-dependent kinases 4 and 6 binding protein|multiple tumor suppressor 2|p14-INK4b|p14_CDK inhibitor|p14_INK4B|p15 CDK inhibitor|p15-INK4b|p15_INK4B |
Position | 9p21 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 17 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Long non-coding RNA ANRIL is required for the PRC2 recruitment to and silencing of p15(INK4B) tumor suppressor gene. |
reviewed | Aberrant methylation of tumor suppressor genes in patients with refractory anemia with ring sideroblasts. |
reviewed | DNA methylation analysis of tumor suppressor genes in monoclonal gammopathy of undetermined significance. |
reviewed | Genome analysis identifies the p15ink4b tumor suppressor as a direct target of the ZNF217/CoREST complex. |
reviewed | "tumor suppressor genes p15(INK4b), p14(ARF) and p16(INK4a) are located at the 9p21 locus in 26 cryopreserved neurofibromatosis type 1-related malignant peripheral nerve sheath tumors." |
reviewed | Inactivation of tumor suppressor genes p15(INK4b) and p16(INK4a) in primary cutaneous B cell lymphoma. |
reviewed | Evaluation of alterations in the tumor suppressor genes INK4A and INK4B in human bladder tumors. |
reviewed | tumor suppressor INK4: refinement of p16INK4A structure and determination of p15INK4B structure by comparative modeling and NMR data. |
reviewed | Rearrangement and allelic imbalance on chromosome 5 leads to homozygous deletions in the CDKN2A/2B tumor suppressor gene region in rat endometrial cancer. |
reviewed | An AC-repeat adjacent to mouse Cdkn2B allows the detection of specific allelic losses in the p15INK4b and p16INK4a tumor suppressor genes. |
| More detail of all 17 literatures about CDKN2B | |
|
Pathways and Diseases |
|
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Pathway | Regulation of nuclear SMAD2/3 signaling;PID Curated;200002 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Disease | Type 2 diabetes;NHGRI |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | Vertical cup-disc ratio;NHGRI |
Disease | Cancer;FunDO |
Disease | Oral cancer;FunDO |
Disease | Diabetes;KEGG DISEASE |
Disease | AGING;GAD |
Disease | Nasopharyngeal carcinoma;NHGRI |
Disease | type 2 diabetes;GAD |
Disease | Actinic keratosis;FunDO |
Disease | hypertension;GAD |
Disease | Osteosarcoma;KEGG DISEASE;H00036 |
Disease | coronary heart disease;GAD |
Disease | METABOLIC;GAD |
Disease | Malignant pleural mesothelioma;KEGG DISEASE;H00015 |
Disease | diabetes, type 2;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Stroke;GAD |
Disease | CANCER;GAD |
Disease | Coronary Disease;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | Glioma;GAD |
Disease | myocardial infarction (early onset);GAD |
Disease | Cancers;KEGG DISEASE |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | Cancers of soft tissues and bone;KEGG DISEASE |
Disease | Intracranial Aneurysm;GAD |
Disease | Metaplastic polyp;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | Myocardial Infarction;GAD |
Disease | Type II diabetes mellitus;KEGG DISEASE;H00409 |
Disease | physical function;GAD |
Disease | myocardial infarct;GAD |
|
External Links |
|
Links to Entrez Gene | 1030 |
Links to all GeneRIF Items | 1030 |
Links to iHOP | 1030 |
|
Sequence Information |
|
Nucleotide Sequence |
>1030 : length: 417 atgcgcgaggagaacaagggcatgcccagtgggggcggcagcgatgagggtctggccagc gccgcggcgcggggactagtggagaaggtgcgacagctcctggaagccggcgcggatccc aacggagtcaaccgtttcgggaggcgcgcgatccaggtcatgatgatgggcagcgcccgc gtggcggagctgctgctgctccacggcgcggagcccaactgcgcagaccctgccactctc acccgaccggtgcatgatgctgcccgggagggcttcctggacacgctggtggtgctgcac cgggccggggcgcggctggacgtgcgcgatgcctggggtcgtctgcccgtggacttggcc gaggagcggggccaccgcgacgttgcagggtacctgcgcacagccacgggggactga |
Protein Sequence |
>1030 : length: 138 MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA EERGHRDVAGYLRTATGD |