|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1473 |
Name | CST5 |
Synonym | -;cystatin D;CST5;cystatin D |
Definition | cystatin 5|cystatin-5|cystatin-D|cysteine-proteinase inhibitor |
Position | 20p11.21 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | "activation of the RhoA-ROCK-p38MAPK-MSK signaling pathway is essential for the regulation of the phenotype and of the CST5/cystatin D candidate tumor suppressor and other target genes by 1,25(OH)2D3 in colon cancer cells". |
potential | Cystatin D is a candidate tumor suppressor gene induced by vitamin D in human colon cancer cells. |
| More detail of all 2 literatures about CST5 | |
|
Pathways and Diseases |
|
Pathway | Salivary secretion;KEGG PATHWAY;hsa04970 |
Disease | response to TNF antagonist treatment;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | Response to TNF antagonist treatment;NHGRI |
|
External Links |
|
Links to Entrez Gene | 1473 |
Links to all GeneRIF Items | 1473 |
Links to iHOP | 1473 |
|
Sequence Information |
|
Nucleotide Sequence |
>1473 : length: 429 atgatgtggcccatgcacaccccactgctgctgctgactgccttgatggtggccgtggcc gggagtgcctcggcccaatctaggaccttggcaggtggcatccatgccacagacctcaat gacaagagtgtgcagtgtgccctggactttgccatcagcgagtacaacaaggtcattaat aaggatgagtactacagccgccctctgcaggtgatggctgcctaccagcagatcgtgggt ggggtgaactactacttcaatgtgaagttcggtcgaaccacatgcaccaagtcccagccc aacttggacaactgtcccttcaatgaccagccaaaactgaaagaggaagagttctgctct ttccagatcaatgaagttccctgggaggataaaatttccattctgaactacaagtgccgg aaagtctag |
Protein Sequence |
>1473 : length: 142 MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVIN KDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS FQINEVPWEDKISILNYKCRKV |