|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 388 |
Name | RHOB |
Synonym | ARH6|ARHB|MST081|MSTP081|RHOH6;ras homolog gene family, member B;RHOB;ras homolog gene family, member B |
Definition | Aplysia RAS-related homolog 6|h6|oncogene RHO H6|rho cDNA clone 6|rho-related GTP-binding protein RhoB |
Position | 2p24 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 5 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "miR-21 targets the tumor suppressor RhoB and regulates proliferation, invasion and apoptosis in colorectal cancer cells." |
potential | appears that RhoB plays an opposing role from that of RhoA and/or RhoC in gastric cancer cells. Our work suggests that RhoB may play a tumor suppressor role and subsequently may have potential implications in future targeted therapy. |
reviewed | "miR-21 promotes multiple components of the metastatic phenotype in vitro by regulating several important tumor suppressors, including RHOB." |
potential | "Sudy demonstrates that RhoB expression is frequently downregulated in non-small-cell lung cancer (NSCLC) by multiple mechanisms, suggesting that RhoB is a candidate tumor suppressor gene for NSCLC." |
reviewed | RhoB has a role as a tumor suppressor in lung neoplasms. |
| More detail of all 5 literatures about RHOB | |
|
Pathways and Diseases |
|
Pathway | Axon guidance;Reactome;REACT:18266 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Axon guidance mediated by Slit/Robo;PANTHER;P00008 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | PDGF signaling pathway;PANTHER;P00047 |
Pathway | Signaling by Rho GTPases;Reactome;REACT:11044 |
Pathway | Angiogenesis;PANTHER;P00005 |
Pathway | Integrin signalling pathway;PANTHER;P00034 |
Pathway | Ras Pathway;PANTHER;P04393 |
Pathway | Cytoskeletal regulation by Rho GTPase;PANTHER;P00016 |
Disease | Cancer;FunDO |
Disease | Polyarthritis;FunDO |
|
External Links |
|
Links to Entrez Gene | 388 |
Links to all GeneRIF Items | 388 |
Links to iHOP | 388 |
|
Sequence Information |
|
Nucleotide Sequence |
>388 : length: 591 atggcggccatccgcaagaagctggtggtggtgggcgacggcgcgtgtggcaagacgtgc ctgctgatcgtgttcagtaaggacgagttccccgaggtgtacgtgcccaccgtcttcgag aactatgtggccgacattgaggtggacggcaagcaggtggagctggcgctgtgggacacg gcgggccaggaggactacgaccgcctgcggccgctctcctacccggacaccgacgtcatt ctcatgtgcttctcggtggacagcccggactcgctggagaacatccccgagaagtgggtc cccgaggtgaagcacttctgtcccaatgtgcccatcatcctggtggccaacaaaaaagac ctgcgcagcgacgagcatgtccgcacagagctggcccgcatgaagcaggaacccgtgcgc acggatgacggccgcgccatggccgtgcgcatccaagcctacgactacctcgagtgctct gccaagaccaaggaaggcgtgcgcgaggtcttcgagacggccacgcgcgccgcgctgcag aagcgctacggctcccagaacggctgcatcaactgctgcaaggtgctatga |
Protein Sequence |
>388 : length: 196 MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD LRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ KRYGSQNGCINCCKVL |