|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4495 |
Name | MT1G |
Synonym | MT1|MT1K;metallothionein 1G;MT1G;metallothionein 1G |
Definition | MT-1G|MT-1K|MT-IG|metallothionein 1K|metallothionein-1G|metallothionein-1K|metallothionein-IG |
Position | 16q13 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | MT1G acts as a tumor suppressor gene in hepatocellular carcinoma. |
| More detail of all 1 literatures about MT1G | |
|
External Links |
|
Links to Entrez Gene | 4495 |
Links to all GeneRIF Items | 4495 |
Links to iHOP | 4495 |
|
Sequence Information |
|
Nucleotide Sequence |
>4495 : length: 186 atggaccccaactgctcctgtgccgctggtgtctcctgcacctgcgccagctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccaaggctgcatctgcaaaggggcatcggagaagtgcagctgctgc gcctga |
Protein Sequence |
>4495 : length: 61 MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCC A |