| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10432 |
Name | RBM14 |
Synonym | COAA|PSP2|SIP|SYTIP1|TMEM137;RNA binding motif protein 14;RBM14;RNA binding motif protein 14 |
Definition | RNA-binding protein 14|RRM-containing coactivator activator/modulator|SYT-interacting protein|paraspeckle protein 2|synaptotagmin-interacting protein|transmembrane protein 137 |
Position | 11q13.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 13896 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 10432 |
Links to all GeneRIF Items | 10432 |
Links to iHOP | 10432 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>10432 : length: 471 atgaagatattcgtgggcaacgtcgacggggcggatacgactccggaggagctggcagcc ctctttgcgccctacggcacggtcatgagctgcgccgtcatgaaacagttcgccttcgtg cacatgcgcgagaacgcgggcgcgctgcgcgccatcgaagccctgcacggccacgagctg cggccggggcgcgcgctcgtggtggagatgtcgcgcccaaggcctcttaatacttggaag attttcgtgggcaatgtgtcggctgcatgcacgagccaggaactgcgcagcctcttcgag cgccgcggacgcgtcatcgagtgtgacgtggtgaaagactacgcgtttgttcacatggag aaggaagcagatgccaaagccgcaatcgcgcagctcaacggcaaagaagtgaagggcaag cgcatcaacgtggaactctccaccaagggtatggttccgaccggcgtttag |
Protein Sequence |
>10432 : length: 156 MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME KEADAKAAIAQLNGKEVKGKRINVELSTKGMVPTGV |