| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8099 |
Name | CDK2AP1 |
Synonym | DOC1|DORC1|ST19|doc-1|p12DOC-1;cyclin-dependent kinase 2 associated protein 1;CDK2AP1;cyclin-dependent kinase 2 associated protein 1 |
Definition | CDK2-associated protein 1|Deleted in oral cancer-1|cyclin-dependent kinase 2-associated protein 1|deleted in oral cancer 1|putative oral cancer suppressor |
Position | 12q24.31 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 4695 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 8099 |
Links to all GeneRIF Items | 8099 |
Links to iHOP | 8099 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>8099 : length: 348 atgtcttacaaaccgaacttggccgcgcacatgcccgccgccgccctcaacgccgctggg agtgtccactcgccttccaccagcatggcaacgtcttcacagtaccgccagctgctcagt gactacgggccaccgtccctaggctacacccagggaactgggaacagccaggtgccccaa agcaaatacgcggagctgctggccatcattgaagagctggggaaggagatcagacccacg tacgcagggagcaagagtgccatggagaggctgaagcgcggcatcattcacgctagagga ctggttcgggagtgcttggcagaaacggaacggaatgccagatcctag |
Protein Sequence |
>8099 : length: 115 MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQ SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS |