| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10663 |
Name | CXCR6 |
Synonym | BONZO|CD186|STRL33|TYMSTR;chemokine (C-X-C motif) receptor 6;CXCR6;chemokine (C-X-C motif) receptor 6 |
Definition | C-X-C chemokine receptor type 6|CDw186|CXC-R6|CXCR-6|G protein-coupled receptor|G-protein coupled receptor STRL33|G-protein coupled receptor bonzo |
Position | 3p21 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "We observed linkage evidence in four regions: 3q22 ([median log of the odds (LOD) = 3.43]), 3p12 (median LOD) = 2.35), 2p22 (median LOD = 2.21), and 13q21 (median LOD = 2.09). When used in conjunction with the non-parametric bootstrap, our approach yields high-resolution to identify candidate gene regions containing putative BMPR2-interacting genes. Imputation of the disease model by LOD-score maximization indicates that the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically." |
| More detail of all Human literatures about CXCR6 | |
|
Pathways and Diseases |
|
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Chemokine receptors bind chemokines;PID Reactome;500406 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Disease | Embryoma;FunDO |
Disease | pneumocystis carinii pneumonia;GAD |
Disease | HIV;GAD |
Disease | Peripheral nerve sheath cancer;FunDO |
Disease | Viremia;FunDO |
Disease | INFECTION;GAD |
Disease | Neurilemmoma;FunDO |
Disease | Graves' disease;FunDO |
Disease | HIV infection;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 10663 |
Links to all GeneRIF Items | 10663 |
Links to iHOP | 10663 |
|
Sequence Information |
|
Nucleotide Sequence |
>10663 : length: 1029 atggcagagcatgattaccatgaagactatgggttcagcagtttcaatgacagcagccag gaggagcatcaagacttcctgcagttcagcaaggtctttctgccctgcatgtacctggtg gtgtttgtctgtggtctggtggggaactctctggtgctggtcatatccatcttctaccat aagttgcagagcctgacggatgtgttcctggtgaacctacccctggctgacctggtgttt gtctgcactctgcccttctgggcctatgcaggcatccatgaatgggtgtttggccaggtc atgtgcaagagcctactgggcatctacactattaacttctacacgtccatgctcatcctc acctgcatcactgtggatcgtttcattgtagtggttaaggccaccaaggcctacaaccag caagccaagaggatgacctggggcaaggtcaccagcttgctcatctgggtgatatccctg ctggtttccttgccccaaattatctatggcaatgtctttaatctcgacaagctcatatgt ggttaccatgacgaggcaatttccactgtggttcttgccacccagatgacactggggttc ttcttgccactgctcaccatgattgtctgctattcagtcataatcaaaacactgcttcat gctggaggcttccagaagcacagatctctaaagatcatcttcctggtgatggctgtgttc ctgctgacccagatgcccttcaacctcatgaagttcatccgcagcacacactgggaatac tatgccatgaccagctttcactacaccatcatggtgacagaggccatcgcatacctgagg gcctgccttaaccctgtgctctatgcctttgtcagcctgaagtttcgaaagaacttctgg aaacttgtgaaggacattggttgcctcccttaccttggggtctcacatcaatggaaatct tctgaggacaattccaagactttttctgcctcccacaatgtggaggccaccagcatgttc cagttatag |
Protein Sequence |
>10663 : length: 342 MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL |