| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10666 |
Name | CD226 |
Synonym | DNAM-1|DNAM1|PTA1|TLiSA1;CD226 molecule;CD226;CD226 molecule |
Definition | CD226 antigen|DNAX accessory molecule 1|DNAX accessory molecule-1|T lineage-specific activation antigen 1 antigen|adhesion glycoprotein|platelet and T cell activation antigen 1 |
Position | 18q22.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "We detected a significant association at the CBLN2 locus mapping to 18q22.3, with the risk allele conferring an odds ratio for PAH of 1.97 (1.59-2.45; P = 7.47 � 10-10)." |
| More detail of all Human literatures about CD226 | |
|
Pathways and Diseases |
|
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell;PID Reactome;500477 |
Disease | Mean platelet volume;NHGRI |
Disease | Lupus erythematosus;FunDO |
Disease | Colon cancer;FunDO |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | Type 1 diabetes;NHGRI |
Disease | HEMATOLOGICAL;GAD |
Disease | type 1 diabetes;GAD |
Disease | Type I diabetes mellitus;KEGG DISEASE;H00408 |
Disease | IMMUNE;GAD |
Disease | Multiple myeloma;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | Diabetes;KEGG DISEASE |
Disease | HIV infection;FunDO |
Disease | mean platelet volume;GAD |
|
External Links |
|
Links to Entrez Gene | 10666 |
Links to all GeneRIF Items | 10666 |
Links to iHOP | 10666 |
|
Sequence Information |
|
Nucleotide Sequence |
>10666 : length: 1011 atggattatcctactttacttttggctcttcttcatgtatacagagctctatgtgaagag gtgctttggcatacatcagttccctttgccgagaacatgtctctagaatgtgtgtatcca tcaatgggcatcttaacacaggtggagtggttcaagatcgggacccagcaggattccata gccattttcagccctactcatggcatggtcataaggaagccctatgctgagagggtttac tttttgaattcaacgatggcttccaataacatgactcttttctttcggaatgcctctgaa gatgatgttggctactattcctgctctctttacacttacccacagggaacttggcagaag gtgatacaggtggttcagtcagatagttttgaggcagctgtgccatcaaatagccacatt gtttcggaacctggaaagaatgtcacactcacttgtcagcctcagatgacgtggcctgtg caggcagtgaggtgggaaaagatccagccccgtcagatcgacctcttaacttactgcaac ttggtccatggcagaaatttcacctccaagttcccaagacaaatagtgagcaactgcagc cacggaaggtggagcgtcatcgtcatccccgatgtcacagtctcagactcggggctttac cgctgctacttgcaggccagcgcaggagaaaacgaaaccttcgtgatgagattgactgta gccgagggtaaaaccgataaccaatataccctctttgtggctggagggacagttttattg ttgttgtttgttatctcaattaccaccatcattgtcattttccttaacagaaggagaagg agagagagaagagatctatttacagagtcctgggatacacagaaggcacccaataactat agaagtcccatctctaccagtcaacctaccaatcaatccatggatgatacaagagaggat atttatgtcaactatccaaccttctctcgcagaccaaagactagagtttaa |
Protein Sequence |
>10666 : length: 336 MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSI AIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQK VIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCN LVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTV AEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNY RSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV |