| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1230 |
Name | CCR1 |
Synonym | CD191|CKR-1|CKR1|CMKBR1|HM145|MIP1aR|SCYAR1;chemokine (C-C motif) receptor 1;CCR1;chemokine (C-C motif) receptor 1 |
Definition | C-C CKR-1|C-C chemokine receptor type 1|CC-CKR-1|CCR-1|LD78 receptor|MIP-1alpha-R|RANTES receptor|RANTES-R|macrophage inflammatory protein 1-alpha receptor |
Position | 3p21 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "We observed linkage evidence in four regions: 3q22 ([median log of the odds (LOD) = 3.43]), 3p12 (median LOD) = 2.35), 2p22 (median LOD = 2.21), and 13q21 (median LOD = 2.09). When used in conjunction with the non-parametric bootstrap, our approach yields high-resolution to identify candidate gene regions containing putative BMPR2-interacting genes. Imputation of the disease model by LOD-score maximization indicates that the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically." |
| More detail of all Human literatures about CCR1 | |
|
Pathways and Diseases |
|
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Disease | IMMUNE;GAD |
Disease | Hepatitis B;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Celiac Disease;GAD |
Disease | Celiac disease;NHGRI |
Disease | Asthma;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Squamous cell cancer;FunDO |
Disease | Endometriosis;FunDO |
Disease | Liver cancer;FunDO |
Disease | Neoplasm metastasis;FunDO |
|
External Links |
|
Links to Entrez Gene | 1230 |
Links to all GeneRIF Items | 1230 |
Links to iHOP | 1230 |
|
Sequence Information |
|
Nucleotide Sequence |
>1230 : length: 1068 atggaaactccaaacaccacagaggactatgacacgaccacagagtttgactatggggat gcaactccgtgccagaaggtgaacgagagggcctttggggcccaactgctgccccctctg tactccttggtatttgtcattggcctggttggaaacatcctggtggtcctggtccttgtg caatacaagaggctaaaaaacatgaccagcatctacctcctgaacctggccatttctgac ctgctcttcctgttcacgcttcccttctggatcgactacaagttgaaggatgactgggtt tttggtgatgccatgtgtaagatcctctctgggttttattacacaggcttgtacagcgag atctttttcatcatcctgctgacgattgacaggtacctggccatcgtccacgccgtgttt gccttgcgggcacggaccgtcacttttggtgtcatcaccagcatcatcatttgggccctg gccatcttggcttccatgccaggcttatacttttccaagacccaatgggaattcactcac cacacctgcagccttcactttcctcacgaaagcctacgagagtggaagctgtttcaggct ctgaaactgaacctctttgggctggtattgcctttgttggtcatgatcatctgctacaca gggattataaagattctgctaagacgaccaaatgagaagaaatccaaagctgtccgtttg atttttgtcatcatgatcatcttttttctcttttggaccccctacaatttgactatactt atttctgttttccaagacttcctgttcacccatgagtgtgagcagagcagacatttggac ctggctgtgcaagtgacggaggtgatcgcctacacgcactgctgtgtcaacccagtgatc tacgccttcgttggtgagaggttccggaagtacctgcggcagttgttccacaggcgtgtg gctgtgcacctggttaaatggctccccttcctctccgtggacaggctggagagggtcagc tccacatctccctccacaggggagcatgaactctctgctgggttctga |
Protein Sequence |
>1230 : length: 355 METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF |