| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1401 |
Name | CRP |
Synonym | PTX1;C-reactive protein, pentraxin-related;CRP;C-reactive protein, pentraxin-related |
Definition | C-reactive protein|pentraxin 1 |
Position | 1q21-q23 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PH | "CRP may contribute to persistent obstruction of proximal pulmonary arteries in chronic thromboembolic pulmonary hypertension by promoting vascular remodelling, endothelial dysfunction and in situ thrombosis." |
| More detail of all Human literatures about CRP | |
|
Pathways and Diseases |
|
Pathway | IL6-mediated signaling events;PID Curated;200124 |
Disease | Premature birth;FunDO |
Disease | Cardiovascular disease;FunDO |
Disease | Intermediate coronary syndrome;FunDO |
Disease | Metabolism disease;FunDO |
Disease | IMMUNE;GAD |
Disease | Polycystic ovary syndrome;FunDO |
Disease | INFECTION;GAD |
Disease | Colon cancer;FunDO |
Disease | PSYCH;GAD |
Disease | C-reactive protein (CRP) concentration;GAD |
Disease | Penile disease;FunDO |
Disease | Protein quantitative trait loci;NHGRI |
Disease | Renal Cell cancer;FunDO |
Disease | Enteritis;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | C-reactive protein;GAD |
Disease | myocardial infarct;GAD |
Disease | C-reactive protein Streptococcus pneumoniae;GAD |
Disease | Ischemia;FunDO |
Disease | Septicemia;FunDO |
Disease | Liver cancer;FunDO |
Disease | Hypercholesterolemia;FunDO |
Disease | Obesity;FunDO |
Disease | stroke, ischemic;GAD |
Disease | cognitive function;GAD |
Disease | coronary heart disease;GAD |
Disease | prostate cancer;GAD |
Disease | Systemic infection;FunDO |
Disease | Cirrhosis;FunDO |
Disease | cancer lung cancer;GAD |
Disease | Periodontal disease;FunDO |
Disease | Hyperinsulinism;FunDO |
Disease | Systemic lupus erythematosus;KEGG DISEASE;H00080 |
Disease | atherosclerosis, generalized C-reactive protein;GAD |
Disease | Crohn's disease;GAD |
Disease | Endometrial cancer;FunDO |
Disease | Pulmonary embolism;FunDO |
Disease | Ovarian cancer;FunDO |
Disease | Other metabolic traits;NHGRI |
Disease | Carcinoma, Squamous Cell;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | Ankylosing spondylitis;FunDO |
Disease | Arthritis;FunDO |
Disease | diabetes, type 2 plasminogen activator inhibitor type 1 levels;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | Macular degeneration;FunDO |
Disease | Asthma;FunDO |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | Esophagus cancer;FunDO |
Disease | Prostate cancer;FunDO |
Disease | protein quantitative trait loci;GAD |
Disease | Dental plaque;FunDO |
Disease | METABOLIC;GAD |
Disease | Capillaries disease;FunDO |
Disease | diabetes, type 2;GAD |
Disease | Lung cancer;NHGRI |
Disease | CARDIOVASCULAR;GAD |
Disease | Late pregnancy;FunDO |
Disease | Vulvar disease;FunDO |
Disease | other metabolic traits;GAD |
Disease | Esophageal Neoplasms;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | peripheral vascular disease;GAD |
Disease | angina;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Select biomarker traits;NHGRI |
Disease | C-reactive protein;NHGRI |
Disease | atherosclerosis, coronary C-reactive protein myocardial infarct;GAD |
Disease | Thrombophilia;FunDO |
Disease | obesity;GAD |
Disease | Embryoma;FunDO |
Disease | lung cancer;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Lymphatic Metastasis;GAD |
Disease | Alzheimer's disease;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | select biomarker traits;GAD |
Disease | Thoracic Neoplasms;GAD |
Disease | CANCER;GAD |
Disease | Myocardial Infarction;GAD |
Disease | Stroke;GAD |
Disease | Kidney failure;FunDO |
Disease | Bronchial hyperreactivity;FunDO |
Disease | insulin;GAD |
Disease | Hypothyroidism;FunDO |
Disease | arthritis lymphopenia nephritis, lupus;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | Metabolic syndrome X;FunDO |
|
External Links |
|
Links to Entrez Gene | 1401 |
Links to all GeneRIF Items | 1401 |
Links to iHOP | 1401 |
|
Sequence Information |
|
Nucleotide Sequence |
>1401 : length: 675 atggagaagctgttgtgtttcttggtcttgaccagcctctctcatgcttttggccagaca gacatgtcgaggaaggcttttgtgtttcccaaagagtcggatacttcctatgtatccctc aaagcaccgttaacgaagcctctcaaagccttcactgtgtgcctccacttctacacggaa ctgtcctcgacccgtgggtacagtattttctcgtatgccaccaagagacaagacaatgag attctcatattttggtctaaggatataggatacagttttacagtgggtgggtctgaaata ttattcgaggttcctgaagtcacagtagctccagtacacatttgtacaagctgggagtcc gcctcagggatcgtggagttctgggtagatgggaagcccagggtgaggaagagtctgaag aagggatacactgtgggggcagaagcaagcatcatcttggggcaggagcaggattccttc ggtgggaactttgaaggaagccagtccctggtgggagacattggaaatgtgaacatgtgg gactttgtgctgtcaccagatgagattaacaccatctatcttggcgggcccttcagtcct aatgtcctgaactggcgggcactgaagtatgaagtgcaaggcgaagtgttcaccaaaccc cagctgtggccctga |
Protein Sequence |
>1401 : length: 224 MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP |