General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information |
|
---|---|
Gene ID | 147381 |
Name | CBLN2 |
Synonym | -;cerebellin 2 precursor;CBLN2;cerebellin 2 precursor |
Definition | cerebellin-2 |
Position | 18q22.3 |
Gene Type | protein-coding |
PAH Type |
Description |
PAH | "We detected a significant association at the CBLN2 locus mapping to 18q22.3, with the risk allele conferring an odds ratio for PAH of 1.97 (1.59-2.45; P = 7.47 × 10-10)." |
PAH | "We detected a significant association at the CBLN2 locus mapping to 18q22.3, with the risk allele conferring an odds ratio for PAH of 1.97 (1.59-2.45; P = 7.47 x 10-10). CBLN2 is expressed in the lung, and its expression is higher in explanted lungs from individuals with PAH and in endothelial cells cultured from explanted PAH lungs. ". |
More detail of all Human literatures about CBLN2 | |
External Links |
|
Links to Entrez Gene | 147381 |
Links to all GeneRIF Items | 147381 |
Links to iHOP | 147381 |
Sequence Information |
|
Nucleotide Sequence |
>147381 : length: 675 atgcaggcgcccggccgggggccactcgggctgcggctgatgatgcccgggcgccggggg gcgctgcgcgagccgggcggctgcggatcctgcctgggggtggcgctggccctgctgttg ctgctactgcccgcctgctgccccgtgcgggcgcagaacgacacggagcccatcgtgctg gagggcaagtgcctggtggtgtgcgactccagcccgtcggcggacggcgccgtcacctcc tccctaggcatctccgtgcgctccggcagcgccaaggtggccttctccgccacgcggagc accaaccacgagccgtccgagatgagcaaccgcaccatgaccatctatttcgaccaggta ttagtaaatattggcaaccactttgatcttgcttccagtatatttgtagcaccgagaaaa gggatttatagcttcagcttccacgtggtcaaagtgtataacagacaaaccatccaggtc agtttaatgcagaatggctacccagtgatctcggcctttgcaggagaccaggatgtcacc agagaagctgctagcaatggcgtgctgctgctcatggaaagggaagacaaagtgcatctc aaacttgagagaggcaacctcatggggggctggaaatactccacattctcgggcttcttg gtgtttcctctataa |
Protein Sequence |
>147381 : length: 224 MQAPGRGPLGLRLMMPGRRGALREPGGCGSCLGVALALLLLLLPACCPVRAQNDTEPIVL EGKCLVVCDSSPSADGAVTSSLGISVRSGSAKVAFSATRSTNHEPSEMSNRTMTIYFDQV LVNIGNHFDLASSIFVAPRKGIYSFSFHVVKVYNRQTIQVSLMQNGYPVISAFAGDQDVT REAASNGVLLLMEREDKVHLKLERGNLMGGWKYSTFSGFLVFPL |