| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1535 |
Name | CYBA |
Synonym | p22-PHOX;cytochrome b-245, alpha polypeptide;CYBA;cytochrome b-245, alpha polypeptide |
Definition | cytochrome b light chain|cytochrome b(558) alpha chain|cytochrome b(558) alpha-subunit|cytochrome b, alpha polypeptide|cytochrome b-245 light chain|cytochrome b558 subunit alpha|flavocytochrome b-558 alpha polypeptide|neutrophil cytochrome b 22 kDa polype |
Position | 16q24 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Conclusion: PPHN increases p22(phox) and Nox4 expression and activity resulting in elevated H(2)O(2) levels in PPHN PA. |
| More detail of all Human literatures about CYBA | |
|
Pathways and Diseases |
|
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | RAC1 signaling pathway;PID Curated;200190 |
Pathway | Phagosome;KEGG PATHWAY;hsa04145 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Disease | Granulomatous disease;FunDO |
Disease | hypertension vascular aging;GAD |
Disease | oxidative stress;GAD |
Disease | Cardiovascular disease;FunDO |
Disease | vasodilation, flow-mediated;GAD |
Disease | cardiovascular;GAD |
Disease | Porcine reproductive and respiratory syndrome;FunDO |
Disease | Hyperglycemia;FunDO |
Disease | Asthma;FunDO |
Disease | Polyarthritis;FunDO |
Disease | obesity;GAD |
Disease | vascular NAD(P)H oxidase activity;GAD |
Disease | HIV infection;FunDO |
Disease | Hypercholesterolemia;FunDO |
Disease | Kidney Failure, Acute;GAD |
Disease | hypertension;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | IMMUNE;GAD |
Disease | Leukemia;FunDO |
Disease | METABOLIC;GAD |
Disease | periodontitis;GAD |
Disease | coronary heart disease in younger individuals.;GAD |
Disease | NADPH Oxidase;GAD |
Disease | Kidney disease;FunDO |
Disease | hypertension NADPH oxidase activity;GAD |
Disease | Retinal disease;FunDO |
Disease | Insulin Resistance;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | CANCER;GAD |
Disease | Cerebrovascular disorder;FunDO |
Disease | cerebrovascular disease;GAD |
Disease | Primary immunodeficiency;KEGG DISEASE |
Disease | cholesterol;GAD |
Disease | IGA glomerulonephritis;FunDO |
Disease | cervical intraepithelial neoplasia grade 3;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | coronary endothelial vasodilator function;GAD |
Disease | Chronic granulomatous disease;KEGG DISEASE;H00098 |
Disease | cardiac death cardiovascular disease oxidative stress;GAD |
Disease | Atherosclerosis;GAD |
Disease | RENAL;GAD |
Disease | Chronic granulomatous disease, autosomal, due to deficiency of CYBA;OMIM |
Disease | Atherosclerosis;FunDO |
|
External Links |
|
Links to Entrez Gene | 1535 |
Links to all GeneRIF Items | 1535 |
Links to iHOP | 1535 |
|
Sequence Information |
|
Nucleotide Sequence |
>1535 : length: 588 atggggcagatcgagtgggccatgtgggccaacgaacaggcgctggcgtccggcctgatc ctcatcaccgggggcatcgtggccacagctgggcgcttcacccagtggtactttggtgcc tactccattgtggcgggcgtgtttgtgtgcctgctggagtacccccgggggaagaggaag aagggctccaccatggagcgctggggacagaagtacatgaccgccgtggtgaagctgttc gggccctttaccaggaattactatgttcgggccgtcctgcatctcctgctctcggtgccc gccggcttcctgctggccaccatccttgggaccgcctgcctggccattgcgagcggcatc tacctactggcggctgtgcgtggcgagcagtggacgcccatcgagcccaagccccgggag cggccgcagatcggaggcaccatcaagcagccgcccagcaaccccccgccgcggcccccg gccgaggcccgcaagaagcccagcgaggaggaggctgcggtggcggcggggggacccccg ggaggtccccaggtcaaccccatcccggtgaccgacgaggtcgtgtga |
Protein Sequence |
>1535 : length: 195 MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP GGPQVNPIPVTDEVV |