General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information |
|
---|---|
Gene ID | 1636 |
Name | ACE |
Synonym | ACE1|CD143|DCP|DCP1|ICH|MVCD3;angiotensin I converting enzyme (peptidyl-dipeptidase A) 1;ACE;angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 |
Definition | CD143 antigen|angiotensin I converting enzyme peptidyl-dipeptidase A 1 transcript|angiotensin converting enzyme, somatic isoform|angiotensin-converting enzyme|carboxycathepsin|dipeptidyl carboxypeptidase 1|dipeptidyl carboxypeptidase I|kininase II|peptida |
Position | 17q23.3 |
Gene Type | protein-coding |
PAH Type |
Description |
PAH | Deletion polymorphisms in the angiotensin converting enzyme gene are associated with pulmonary hypertension evoked by exercise challenge in patients with chronic obstructive pulmonary disease. |
PAH | Association between the angiotensin-converting enzyme gene polymorphisms and tissue oxygenation during exercise in patients with COPD. |
PAH | Pulmonary capillary endothelial metabolic dysfunction: severity in pulmonary arterial hypertension related to connective tissue disease versus idiopathic pulmonary arterial hypertension. |
PAH | Angiotensin-converting enzyme gene does not contribute to genetic susceptibility to systemic sclerosis in European Caucasians. |
PAH | Polymorphism in the angiotensin II type 1 receptor (AGTR1) is associated with age at diagnosis in pulmonary arterial hypertension. |
More detail of all Human literatures about ACE | |
Pathways and Diseases |
|
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410 |
Pathway | Renin-angiotensin system;KEGG PATHWAY;hsa04614 |
Disease | cognitive impairment;GAD |
Disease | Premature birth;FunDO |
Disease | obstetric cholestasis;GAD |
Disease | Cardiovascular disease;FunDO |
Disease | SARS, progression of;OMIM |
Disease | polydipsia;GAD |
Disease | coronary heart disease;GAD |
Disease | plasma antigen levels of plasminogen activator inhibitor-1;GAD |
Disease | diabetic nephropathy and retinopathy.;GAD |
Disease | non-ST-elevation acute coronary syndromes;GAD |
Disease | cardiac death;GAD |
Disease | Psoriasis;FunDO |
Disease | Vascular dementia;FunDO |
Disease | polymetabolic syndrome;GAD |
Disease | DEVELOPMENTAL;GAD |
Disease | Depression;FunDO |
Disease | Metabolism disease;FunDO |
Disease | longevity;GAD |
Disease | early onset ischemic heart disease.;GAD |
Disease | IMMUNE;GAD |
Disease | Parkinson's disease;GAD |
Disease | bleeding complications;GAD |
Disease | Alzheimer disease, susceptibility to;OMIM |
Disease | carotid arterial wall thickness;GAD |
Disease | Colon cancer;FunDO |
Disease | elevated ACE;GAD |
Disease | PSYCH;GAD |
Disease | creatinine;GAD |
Disease | Bronchopulmonary dysplasia;FunDO |
Disease | Subacute sclerosing panencephalitis;FunDO |
Disease | Heart Failure;GAD |
Disease | Age-associated memory impairment;GAD |
Disease | REPRODUCTION;GAD |
Disease | Hypertension;FunDO |
Disease | ARDS;GAD |
Disease | insulin sensitivity;GAD |
Disease | athletic performance;GAD |
Disease | anemia C-reactive protein;GAD |
Disease | left ventricular hypertrophy;GAD |
Disease | affective disorder;GAD |
Disease | carotid and femoral artery stiffness;GAD |
Disease | Hyperhomocysteinemia;FunDO |
Disease | Infectious lung disease;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | serum ACE concentration and CAD;GAD |
Disease | sarcoidosis;GAD |
Disease | Transient hypertension of pregnancy;FunDO |
Disease | renal disease;GAD |
Disease | Essential Hypertension;GAD |
Disease | metabolic syndrome;GAD |
Disease | Connective tissue disease;FunDO |
Disease | Type 2 Diabetes Mellitus;GAD |
Disease | myocardial infarct;GAD |
Disease | Myocardial Ischemia;GAD |
Disease | polycystic kidney disease;GAD |
Disease | Ankylosing spondylitis;FunDO |
Disease | Tobacco Use Disorder;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | insulin left ventricular mass;GAD |
Disease | pregnancy loss, recurrent;GAD |
Disease | heart disease;GAD |
Disease | Respiratory distress syndrome;FunDO |
Disease | cardiovascular;GAD |
Disease | Migraine;FunDO |
Disease | Liver cancer;FunDO |
Disease | left ventricular mass;GAD |
Disease | Ulcerative colitis;FunDO |
Disease | postprandial hyperglycaemia;GAD |
Disease | bipolar affective disorder;GAD |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | hypertension;GAD |
Disease | stroke, ischemic;GAD |
Disease | Dermatitis;FunDO |
Disease | Chronic rejection of renal transplant;FunDO |
Disease | nephroangiosclerosis;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | kidney transplant;GAD |
Disease | renal disease, end stage;GAD |
Disease | esophageal varices;GAD |
Disease | cardiovascular disease;GAD |
Disease | ACE activity;GAD |
Disease | increased vascular reactivity;GAD |
Disease | Systemic infection;FunDO |
Disease | Thromboembolism;GAD |
Disease | lipid profiles;GAD |
Disease | Kidney disease;FunDO |
Disease | carotid wall thickening;GAD |
Disease | preeclampsia;GAD |
Disease | coronary atherosclerosis;GAD |
Disease | Insulin Resistance;GAD |
Disease | diabetes, type 1;GAD |
Disease | systemic sclerosis;GAD |
Disease | coronary artery disease and myocardial infarction;GAD |
Disease | cerebral atherosclerosis;GAD |
Disease | Kidney Failure, Chronic;GAD |
Disease | Endometrial cancer;FunDO |
Disease | suicide;GAD |
Disease | NORMALVARIATION;GAD |
Disease | hypertension, pregnancy induced;GAD |
Disease | End- Stage Renal Disease (ESRD);GAD |
Disease | antiproteinuric effect of angiotensin I-converting enzyme inhibitors;GAD |
Disease | Behcet syndrome;FunDO |
Disease | nephropathy, diabetic;GAD |
Disease | IGA glomerulonephritis;FunDO |
Disease | COPD;GAD |
Disease | schizophrenia;GAD |
Disease | Heart disease;FunDO |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | ruptured intracranial aneurysms;GAD |
Disease | heart rate variability;GAD |
Disease | Arthritis;FunDO |
Disease | proliferative diabetic retinopathy;GAD |
Disease | Atrial Fibrillation;GAD |
Disease | endothelial dysfunction in normal humans.;GAD |
Disease | Renal tubular dysgenesis;OMIM |
Disease | congenital anomalies;GAD |
Disease | Macular degeneration;FunDO |
Disease | PMV after CABG;GAD |
Disease | early onset of ESRF in PKD1 adult polycystic kidney disease;GAD |
Disease | lupus erythematosus;GAD |
Disease | Asthma;FunDO |
Disease | angiotensin-converting enzyme inhibitor-related cough;GAD |
Disease | Ischemia;GAD |
Disease | Aortic atherosclerosis in diabetes mellitus;GAD |
Disease | AGING;GAD |
Disease | ACEI-related cough;GAD |
Disease | Esophagus cancer;FunDO |
Disease | Neoplasm metastasis;FunDO |
Disease | Hypoglycemia;FunDO |
Disease | reflux nephropathy;GAD |
Disease | Systemic Lupus Erythematosus (SLE);GAD |
Disease | Prostate cancer;FunDO |
Disease | Chronic fatigue syndrome;FunDO |
Disease | Anemia;FunDO |
Disease | Leukemia;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | myotonic dystrophy;GAD |
Disease | METABOLIC;GAD |
Disease | albuminuria hypertension;GAD |
Disease | Allograft rejection;KEGG DISEASE;H00083 |
Disease | restenosis;GAD |
Disease | elevated fasting blood glucose levels;GAD |
Disease | circulating levels of plasminogen activator inhibitor-1;GAD |
Disease | diabetes, type 2;GAD |
Disease | Fibroid tumor;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | alcoholism;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Schizophrenia;FunDO |
Disease | Exercise-induced changes in insulin;GAD |
Disease | Myocardial infarction, susceptibility to;OMIM |
Disease | Microvascular complications of diabetes 3;OMIM |
Disease | Polycythemia;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | posttransplantation erythrocytosis;GAD |
Disease | protein excretion, urinary;GAD |
Disease | blood pressure, arterial;GAD |
Disease | Angiotensin I-converting enzyme, benign serum increase;OMIM |
Disease | carotid atherosclerosis;GAD |
Disease | Cough;GAD |
Disease | IgA nephropathy;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Obesity;FunDO |
Disease | coronary heart disease in non-insulin-dependent diabetic;GAD |
Disease | Atherosclerosis;GAD |
Disease | diabetic nephropathy;GAD |
Disease | Thrombophilia;FunDO |
Disease | Angiotensin-converting enzyme activity;NHGRI |
Disease | Alzheimer's disease;GAD |
Disease | angiotensin-converting enzyme genotype;GAD |
Disease | atrial natriuretic peptide activity after exercise;GAD |
Disease | lipid metabolism;GAD |
Disease | obesity;GAD |
Disease | progressive renal damage;GAD |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | sleep apnea;GAD |
Disease | Parkinson disease;FunDO |
Disease | Embryoma;FunDO |
Disease | vascular disease;GAD |
Disease | Chronic simple glaucoma;FunDO |
Disease | Gaucher disease;GAD |
Disease | VISION;GAD |
Disease | nephropathy in other diseases;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | nephropathy;GAD |
Disease | chronic obstructive pulmonary disease;GAD |
Disease | Asthma;GAD |
Disease | blood pressure;GAD |
Disease | Proteinuria;FunDO |
Disease | Sarcoidosis;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | arterial wall changes;GAD |
Disease | CHEMDEPENDENCY;GAD |
Disease | endurance performance;GAD |
Disease | cardiovascular risk factors;GAD |
Disease | Leukoaraiosis;GAD |
Disease | Familial Mediterranean fever;FunDO |
Disease | Myocardial Infarction;GAD |
Disease | Stroke;GAD |
Disease | higher blood pressure after hospitalization in normotensi;GAD |
Disease | the extent of exercise-induced left ventricular growth in endurance athletes;GAD |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | angiotensin-converting enzyme inhibitors;GAD |
Disease | sarcoidosis.;GAD |
Disease | coronary artery plaque calcification;GAD |
Disease | Fatigue Syndrome, Chronic;GAD |
Disease | Testicular dysfunction;FunDO |
Disease | malignant vascular injury;GAD |
Disease | Angiotensin-converting enzyme activity;GAD |
Disease | Severe acute respiratory syndrome;FunDO |
Disease | cardiomyopathy;GAD |
Disease | muscle testing;GAD |
Disease | failure of renoprotective therapy;GAD |
Disease | RENAL;GAD |
Disease | Lupus;GAD |
Disease | Metabolic syndrome X;FunDO |
External Links |
|
Links to Entrez Gene | 1636 |
Links to all GeneRIF Items | 1636 |
Links to iHOP | 1636 |
Sequence Information |
|
Nucleotide Sequence |
>1636 : length: 3921 atgggggccgcctcgggccgccgggggccggggctgctgctgccgctgccgctgctgttg ctgctgccgccgcagcccgccctggcgttggaccccgggctgcagcccggcaacttttct gctgacgaggccggggcgcagctcttcgcgcagagctacaactccagcgccgaacaggtg ctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgcggagaatgca aggcgccaggaggaagcagccctgctcagccaggagtttgcggaggcctggggccagaag gccaaggagctgtatgaaccgatctggcagaacttcacggacccgcagctgcgcaggatc atcggagctgtgcgcaccctgggctctgccaacctgcccctggctaagcggcagcagtac aacgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctccccaac aagactgccacctgctggtccctggacccagatctcaccaacatcctggcttcctcgcga agctacgccatgctcctgtttgcctgggagggctggcacaacgctgcgggcatcccgctg aaaccgctgtacgaggatttcactgccctcagcaatgaagcctacaagcaggacggcttc acagacacgggggcctactggcgctcctggtacaactcccccaccttcgaggacgatctg gaacacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgccgc gcactgcatcgccgatacggagacagatacatcaacctcaggggacccatccctgctcat ctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcctttc ccagacaagcccaacctcgatgtcaccagtactatgctgcagcagggctggaacgccacg cacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcctccc gagttctgggaagggtcgatgctggagaagccggccgacgggcgggaagtggtgtgccac gcctcggcttgggacttctacaacaggaaagacttcaggatcaagcagtgcacacgggtc acgatggaccagctctccacagtgcaccatgagatgggccatatacagtactacctgcag tacaaggatctgcccgtctccctgcgtcggggggccaaccccggcttccatgaggccatt ggggacgtgctggcgctctcggtctccactcctgaacatctgcacaaaatcggcctgctg gaccgtgtcaccaatgacacggaaagtgacatcaattacttgctaaaaatggcactggaa aaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtctttagt gggcgtacccccccttcccgctacaacttcgactggtggtatcttcgaaccaagtatcag gggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagtttcat gttccaaatgtgacaccatacatcaggtactttgtgagttttgtcctgcagttccagttc catgaagccctgtgcaaggaggcaggctatgagggcccactgcaccagtgtgacatctac cggtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccaggccc tggcaggaggtgctgaaggacatggtcggcttagatgccctggatgcccagccgctgctc aagtacttccagccagtcacccagtggctgcaggagcagaaccagcagaacggcgaggtc ctgggctggcccgagtaccagtggcacccgccgttgcctgacaactacccggagggcata gacctggtgactgatgaggctgaggccagcaagtttgtggaggaatatgaccggacatcc caggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacatcaccaca gagaccagcaagattctgctgcagaagaacatgcaaatagccaaccacaccctgaagtac ggcacccaggccaggaagtttgatgtgaaccagttgcagaacaccactatcaagcggatc ataaagaaggttcaggacctagaacgggcagcactgcctgcccaggagctggaggagtac aacaagatcctgttggatatggaaaccacctacagcgtggccactgtgtgccacccgaat ggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacgtcccggaaatat gaagacctgttatgggcatgggagggctggcgagacaaggcggggagagccatcctccag ttttacccgaaatacgtggaactcatcaaccaggctgcccggctcaatggctatgtagat gcaggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggagcgg ctcttccaggagctgcagccactctacctcaacctgcatgcctacgtgcgccgggccctg caccgtcactacggggcccagcacatcaacctggaggggcccattcctgctcacctgctg gggaacatgtgggcgcagacctggtccaacatctatgacttggtggtgcccttcccttca gccccctcgatggacaccacagaggctatgctaaagcagggctggacgcccaggaggatg tttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgagttc tggaacaagtcgatgctggagaagccaaccgacgggcgggaggtggtctgccacgcctcg gcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaacttg gaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtacaaa gacttacctgtggccttgagggagggtgccaaccccggcttccatgaggccattggggac gtgctagccctctcagtgtctacgcccaagcacctgcacagtctcaacctgctgagcagt gagggtggcagcgacgagcatgacatcaactttctgatgaagatggcccttgacaagatc gcctttatccccttcagctacctcgtcgatcagtggcgctggagggtatttgatggaagc atcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggcctc tgccccccagtgcccaggactcaaggtgactttgacccaggggccaagttccacattcct tctagcgtgccttacatcaggtactttgtcagcttcatcatccagttccagttccacgag gcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccagtcc aaggaggccgggcagcgcctggcgaccgccatgaagctgggcttcagtaggccgtggccg gaagccatgcagctgatcacgggccagcccaacatgagcgcctcggccatgttgagctac ttcaagccgctgctggactggctccgcacggagaacgagctgcatggggagaagctgggc tggccgcagtacaactggacgccgaactccgctcgctcagaagggcccctcccagacagc ggccgcgtcagcttcctgggcctggacctggatgcgcagcaggcccgcgtgggccagtgg ctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcggctc ttcagcatccgccaccgcagcctccaccggcactcccacgggccccagttcggctccgag gtggagctgagacactcctga |
Protein Sequence |
>1636 : length: 1306 MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS |