| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 1843 |
Name | DUSP1 |
Synonym | CL100|HVH1|MKP-1|MKP1|PTPN10;dual specificity phosphatase 1;DUSP1;dual specificity phosphatase 1 |
Definition | MAP kinase phosphatase 1|dual specificity protein phosphatase 1|dual specificity protein phosphatase hVH1|mitogen-activated protein kinase phosphatase 1|protein-tyrosine phosphatase CL100|serine/threonine specific protein phosphatase |
Position | 5q34 |
Gene Type | protein-coding |
PAH Type | Description |
PH | Mice deficient in Mkp-1 develop more severe pulmonary hypertension and greater lung protein levels of arginase in response to chronic hypoxia. |
| More detail of all Mouse literatures about DUSP1 | |
Pathways and Diseases | |
Pathway | Regulation of p38-alpha and p38-beta;PID Curated;200054 |
Pathway | nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088 |
Pathway | mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | ErbB1 downstream signaling;PID Curated;200113 |
Pathway | Fc-epsilon receptor I signaling in mast cells;PID Curated;200003 |
Pathway | Oxidative stress response;PANTHER;P00046 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Disease | Renal Cell cancer;FunDO |
Disease | Heart failure;FunDO |
Disease | Osteomyelitis;FunDO |
Disease | Rheumatic fever;FunDO |
Disease | Liver tumor;FunDO |
Disease | Vitamin D deficiency;FunDO |
Disease | Bladder cancer;FunDO |
Disease | Neuroblastoma;FunDO |
Disease | Ovary cancer;FunDO |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Depression;FunDO |
Disease | Liver cancer;FunDO |
External Links | |
Links to Entrez Gene | 1843 |
Links to all GeneRIF Items | 1843 |
Links to iHOP | 1843 |
Sequence Information | |
Nucleotide Sequence | >1843 : length: 1104 atggtcatggaagtgggcaccctggacgctggaggcctgcgggcgctgctgggggagcga gcggcgcaatgcctgctgctggactgccgctccttcttcgctttcaacgccggccacatc gccggctctgtcaacgtgcgcttcagcaccatcgtgcggcgccgggccaagggcgccatg ggcctggagcacatcgtgcccaacgccgagctccgcggccgcctgctggccggcgcctac cacgccgtggtgttgctggacgagcgcagcgccgccctggacggcgccaagcgcgacggc accctggccctggcggccggcgcgctctgccgcgaggcgcgcgccgcgcaagtcttcttc ctcaaaggaggatacgaagcgttttcggcttcctgcccggagctgtgcagcaaacagtcg acccccatggggctcagccttcccctgagtactagcgtccctgacagcgcggaatctggg tgcagttcctgcagtaccccactctacgatcagggtggcccggtggaaatcctgcccttt ctgtacctgggcagtgcgtatcacgcttcccgcaaggacatgctggatgccttgggcatc actgccttgatcaacgtctcagccaattgtcccaaccattttgagggtcactaccagtac aagagcatccctgtggaggacaaccacaaggcagacatcagctcctggttcaacgaggcc attgacttcatagactccatcaagaatgctggaggaagggtgtttgtccactgccaggca ggcatttcccggtcagccaccatctgccttgcttaccttatgaggactaatcgagtcaag ctggacgaggcctttgagtttgtgaagcagaggcgaagcatcatctctcccaacttcagc ttcatgggccagctgctgcagtttgagtcccaggtgctggctccgcactgttcggcagag gctgggagccccgccatggctgtgctcgaccgaggcacctccaccaccaccgtgttcaac ttccccgtctccatccctgtccactccacgaacagtgcgctgagctaccttcagagcccc attacgacctctcccagctgctga |
Protein Sequence | >1843 : length: 367 MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP ITTSPSC |