| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1849 |
Name | DUSP7 |
Synonym | MKPX|PYST2;dual specificity phosphatase 7;DUSP7;dual specificity phosphatase 7 |
Definition | dual specificity protein phosphatase 7|dual specificity protein phosphatase PYST2|dual-specificity phosphatase-7 |
Position | 3p21 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "We observed linkage evidence in four regions: 3q22 ([median log of the odds (LOD) = 3.43]), 3p12 (median LOD) = 2.35), 2p22 (median LOD = 2.21), and 13q21 (median LOD = 2.09). When used in conjunction with the non-parametric bootstrap, our approach yields high-resolution to identify candidate gene regions containing putative BMPR2-interacting genes. Imputation of the disease model by LOD-score maximization indicates that the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically." |
| More detail of all Human literatures about DUSP7 | |
|
Pathways and Diseases |
|
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Oxidative stress response;PANTHER;P00046 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Disease | Leukemia;FunDO |
Disease | Embryoma;FunDO |
|
External Links |
|
Links to Entrez Gene | 1849 |
Links to all GeneRIF Items | 1849 |
Links to iHOP | 1849 |
|
Sequence Information |
|
Nucleotide Sequence |
>1849 : length: 1260 atgaaaaaccagctccgcggccccccagcgcgggcgcacatgtcgacttcgggggcggcg gcggctgggggcacccgggcggggtccgagcccggtgcggggtcggggtccggcgcaggc accggggcgggcgcggcgacgggggcaggggccatgccctgcaagagcgccgagtggctg caggaggagctggaggcgcgcggcggcgcgtccttgctgctgctcgactgccggccgcac gagctcttcgagtcgtcgcacatcgagacggccatcaacctggccatcccgggcctcatg ttgcgccgcctgcgcaagggcaacctgcccatccgctccatcatccccaaccacgccgac aaggagcgcttcgccacgcgctgcaaggcggccaccgtgctgctctacgacgaggccacg gccgagtggcagcccgagcccggcgctcccgcctccgtgctcggcctgctcctacagaag ctgcgcgacgacggctgccaggcctactacctccaaggtggtttcaacaagtttcaaaca gagtactctgagcactgcgagaccaacgtggacagctcttcctcgccgagcagctcgcca cccacctcagtgctgggcctggggggcctgcgcatcagctctgactgctccgacggcgag tcggaccgagagctgcccagcagtgccaccgagtcagacggcagccctgtgccatccagc caaccagccttccctgtccagatcctgccctacctctacctcggctgcgccaaggactcc accaacctggacgtgctcggcaagtatggcatcaagtatatcctcaatgtcacacccaac ctacccaacgccttcgagcacggcggcgagttcacctacaagcagatccccatctctgac cactggagccagaacctctcccagttcttccctgaggccatcagcttcattgacgaagcc cgctccaagaagtgtggtgtcctggtgcactgcctggcaggcatcagccgctcagtgacg gtcactgtggcctatctgatgcagaagatgaacctgtcactcaacgacgcctacgacttt gtcaagaggaaaaagtccaacatctcgcccaacttcaacttcatggggcagctgctggac tttgagcggacgctggggctaagcagcccgtgcgacaaccacgcgtcgagtgagcagctc tacttttccacgcccaccaaccacaacctgttcccactcaatacgctggagtccacgtga |
Protein Sequence |
>1849 : length: 419 MKNQLRGPPARAHMSTSGAAAAGGTRAGSEPGAGSGSGAGTGAGAATGAGAMPCKSAEWL QEELEARGGASLLLLDCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHAD KERFATRCKAATVLLYDEATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQT EYSEHCETNVDSSSSPSSSPPTSVLGLGGLRISSDCSDGESDRELPSSATESDGSPVPSS QPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISD HWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDF VKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHASSEQLYFSTPTNHNLFPLNTLEST |