| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 1909 |
Name | EDNRA |
Synonym | ET-A|ETA|ETA-R|ETAR|ETRA|hET-AR;endothelin receptor type A;EDNRA;endothelin receptor type A |
Definition | G protein-coupled receptor|endothelin receptor subtype A|endothelin-1 receptor|endothelin-1-specific receptor |
Position | 4q31.22 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "STRIDE 1: effects of the selective ET(A) receptor antagonist, sitaxsentan sodium, in a patient population with pulmonary arterial hypertension that meets traditional inclusion criteria of previous pulmonary arterial hypertension trials." |
PAH | "The main differences appear to be in safety profiles, with a greater frequency of serum liver function abnormalities occurring with the available dual ET(A)/ET(B) antagonist, and possibly higher rates of peripheral edema noted with selective ET(A) agents. Head-to-head studies will be necessary to resolve the question of whether single vs dual blockade produces better clinical results with fewer side effects in patients with PAH." |
PAH | "Activation of endothelin-1 receptor signaling pathways is associated with neointima formation, neoangiogenesis and irreversible pulmonary artery hypertension in patients with congenital heart disease." |
PAH | Findings suggest a potential link between specific genotypes in the ednra gene and susceptibility to pulmonary arterial hypertension. |
PAH | "Both endothelin A and B receptors were reduced in pulmonary arterial hypertension, particularly type B, and type B signaling through protein kinases was markedly reduced in vascular smooth cells with a mutation in bone morphogenetic protein receptor 2." |
PH | Fibroblast growth factor mediates hypoxia-induced endothelin-- a receptor expression in lung artery smooth muscle cells. |
PH | BMPR2 mutation alters the lung macrophage endothelin-1 cascade in a mouse model and patients with heritable pulmonary artery hypertension. |
| More detail of all Human literatures about EDNRA | |
Pathways and Diseases | |
Pathway | Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270 |
Pathway | Endothelins;PID Curated;200004 |
Pathway | EGFR-dependent Endothelin signaling events;PID Curated;200095 |
Pathway | Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080 |
Pathway | Endothelin signaling pathway;PANTHER;P00019 |
Pathway | Calcium signaling pathway;KEGG PATHWAY;hsa04020 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Disease | Primary tumor;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Kaposi sarcoma;FunDO |
Disease | migraine;GAD |
Disease | Breast cancer;FunDO |
Disease | Glaucoma;FunDO |
Disease | hypertension;GAD |
Disease | Pancreatitis;FunDO |
Disease | VISION;GAD |
Disease | Heart Failure;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | Capillaries disease;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | atherosclerosis, generalized;GAD |
Disease | Renal Cell cancer;FunDO |
Disease | Heart failure;FunDO |
Disease | glaucoma, normal tension;GAD |
Disease | Migraine, resistance to;OMIM |
Disease | Prostate cancer;FunDO |
Disease | Ovarian cancer;FunDO |
Disease | Atherosclerosis;FunDO |
External Links | |
Links to Entrez Gene | 1909 |
Links to all GeneRIF Items | 1909 |
Links to iHOP | 1909 |
Sequence Information | |
Nucleotide Sequence | >1909 : length: 957 atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt gataatcctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag ttctaccaagatgtaaaggactggtggctcttcgggttctatttctgtatgcccttggtg tgcactgcgatcttctacaccctcatgacttgtgagatgttgaacagaaggaatggcagc ttgagaattgccctcagtgaacatcttaagcagcgtcgagaagtggcaaaaacagttttc tgcttggttgtaatttttgctctttgctggttccctcttcatttaagccgtatattgaag aaaactgtgtataacgagatggacaagaaccgatgtgaattacttagtttcttactgctc atggattacatcggtattaacttggcaaccatgaattcatgtataaaccccatagctctg tattttgtgagcaagaaatttaaaaattgtttccagtcatgcctctgctgctgctgttac cagtccaaaagtctgatgacctcggtccccatgaacggaacaagcatccagtggaagaac cacgatcaaaacaaccacaacacagaccggagcagccataaggacagcatgaactga |
Protein Sequence | >1909 : length: 318 METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA SLALGDLIYVVIDLPINVFKFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGS LRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLL MDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKN HDQNNHNTDRSSHKDSMN |