| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 1910 |
Name | EDNRB |
Synonym | ABCDS|ET-B|ET-BR|ETB|ETBR|ETRB|HSCR|HSCR2|WS4A;endothelin receptor type B;EDNRB;endothelin receptor type B |
Definition | endothelin B receptor|endothelin receptor non-selective type |
Position | 13q22 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "The main differences appear to be in safety profiles, with a greater frequency of serum liver function abnormalities occurring with the available dual ET(A)/ET(B) antagonist, and possibly higher rates of peripheral edema noted with selective ET(A) agents. Head-to-head studies will be necessary to resolve the question of whether single vs dual blockade produces better clinical results with fewer side effects in patients with PAH." |
PAH | "Activation of endothelin-1 receptor signaling pathways is associated with neointima formation, neoangiogenesis and irreversible pulmonary artery hypertension in patients with congenital heart disease." |
PAH | "Both endothelin A and B receptors were reduced in pulmonary arterial hypertension, particularly type B, and type B signaling through protein kinases was markedly reduced in vascular smooth cells with a mutation in bone morphogenetic protein receptor 2." |
PAH | Our findings demonstrate that aldosterone modulates an ET(B) cysteinyl thiol redox switch to decrease pulmonary endothelium-derived NO(.) and promote pulmonary arterial hypertension. |
PAH | Our findings demonstrate that aldosterone modulates an ET(B) cysteinyl thiol redox switch to decrease pulmonary endothelium-derived NO(.) and promote pulmonary arterial hypertension. |
PH | Endotoxin causes pulmonary hypertension by upregulating smooth muscle endothelin type-B receptors: role of aldose reductase. |
PH | Endothelial ET(B) limits vascular remodelling and development of pulmonary hypertension during hypoxia. |
PH | BMPR2 mutation alters the lung macrophage endothelin-1 cascade in a mouse model and patients with heritable pulmonary artery hypertension. |
| More detail of all Human literatures about EDNRB | |
Pathways and Diseases | |
Pathway | Melanogenesis;KEGG PATHWAY;hsa04916 |
Pathway | Endothelins;PID Curated;200004 |
Pathway | Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080 |
Pathway | Arf6 trafficking events;PID Curated;200046 |
Pathway | Endothelin signaling pathway;PANTHER;P00019 |
Pathway | Calcium signaling pathway;KEGG PATHWAY;hsa04020 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Disease | Lung cancer;FunDO |
Disease | Hirschsprung Disease;GAD |
Disease | Kaposi sarcoma;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | migraine;GAD |
Disease | Breast cancer;FunDO |
Disease | Down syndrome;FunDO |
Disease | Neoplasm metastasis;FunDO |
Disease | Polycystic kidney;FunDO |
Disease | Leukemia;FunDO |
Disease | atherosclerosis, generalized;GAD |
Disease | Hirschsprung's disease;GAD |
Disease | Bronchial disease;FunDO |
Disease | Retinal disease;FunDO |
Disease | Intraocular melanoma;FunDO |
Disease | Waardenburg syndrome, type 4A;OMIM |
Disease | CARDIOVASCULAR;GAD |
Disease | ABCD syndrome;OMIM |
Disease | Heart failure;FunDO |
Disease | Brain tumor;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Renal Cell cancer;FunDO |
Disease | Hypertension;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | Squamous cell cancer;FunDO |
Disease | Nasopharyngeal cancer;KEGG DISEASE;H00054 |
Disease | Hirschsprung disease, susceptibility to, 2;OMIM |
Disease | Head and neck cancers;KEGG DISEASE |
Disease | Atherosclerosis;FunDO |
External Links | |
Links to Entrez Gene | 1910 |
Links to all GeneRIF Items | 1910 |
Links to iHOP | 1910 |
Sequence Information | |
Nucleotide Sequence | >1910 : length: 1329 atgcagccgcctccaagtctgtgcggacgcgccctggttgcgctggttcttgcctgcggc ctgtcgcggatctggggagaggagagaggcttcccgcctgacagggccactccgcttttg caaaccgcagagataatgacgccacccactaagaccttatggcccaagggttccaacgcc agtctggcgcggtcgttggcacctgcggaggtgcctaaaggagacaggacggcaggatct ccgccacgcaccatctcccctcccccgtgccaaggacccatcgagatcaaggagactttc aaatacatcaacacggttgtgtcctgccttgtgttcgtgctggggatcatcgggaactcc acacttctgagaattatctacaagaacaagtgcatgcgaaacggtcccaatatcttgatc gccagcttggctctgggagacctgctgcacatcgtcattgacatccctatcaatgtctac aagctgctggcagaggactggccatttggagctgagatgtgtaagctggtgcctttcata cagaaagcctccgtgggaatcactgtgctgagtctatgtgctctgagtattgacagatat cgagctgttgcttcttggagtagaattaaaggaattggggttccaaaatggacagcagta gaaattgttttgatttgggtggtctctgtggttctggctgtccctgaagccataggtttt gatataattacgatggactacaaaggaagttatctgcgaatctgcttgcttcatcccgtt cagaagacagctttcatgcagttttacaagacagcaaaagattggtggctattcagtttc tatttctgcttgccattggccatcactgcatttttttatacactaatgacctgtgaaatg ttgagaaagaaaagtggcatgcagattgctttaaatgatcacctaaagcagagacgggaa gtggccaaaaccgtcttttgcctggtccttgtctttgccctctgctggcttccccttcac ctcagcaggattctgaagctcactctttataatcagaatgatcccaatagatgtgaactt ttgagctttctgttggtattggactatattggtatcaacatggcttcactgaattcctgc attaacccaattgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgc ttatgctgctggtgccagtcatttgaagaaaaacagtccttggaggaaaagcagtcgtgc ttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaatacagc tcatcttga |
Protein Sequence | >1910 : length: 442 MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC LKFKANDHGYDNFRSSNKYSSS |