| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3115 |
Name | HLA-DPB1 |
Synonym | DPB1|HLA-DP|HLA-DP1B|HLA-DPB;major histocompatibility complex, class II, DP beta 1;HLA-DPB1;major histocompatibility complex, class II, DP beta 1 |
Definition | HLA DP14-beta chain|HLA class II histocompatibility antigen, DP beta 1 chain|HLA class II histocompatibility antigen, DP(W4) beta chain|HLA-DP histocompatibility type, beta-1 subunit|MHC HLA DPB1|MHC class II HLA-DP-beta|MHC class II HLA-DP-beta-1|MHC cla |
Position | 6p21.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Association of clinical features with HLA in chronic pulmonary thromboembolism. |
PAH | HLA-DPB1 and NFKBIL1 may confer the susceptibility to chronic thromboembolic pulmonary hypertension in the absence of deep vein thrombosis. |
| More detail of all Human literatures about HLA-DPB1 | |
|
Pathways and Diseases |
|
Pathway | Antigen processing and presentation;KEGG PATHWAY;hsa04612 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Asthma;KEGG PATHWAY;hsa05310 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | Staphylococcus aureus infection;KEGG PATHWAY;hsa05150 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Systemic lupus erythematosus;KEGG PATHWAY;hsa05322 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Phagosome;KEGG PATHWAY;hsa04145 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Disease | atopy;GAD |
Disease | leukemia, myeloid;GAD |
Disease | pulmonary hypertension;GAD |
Disease | graft-versus-host disease;GAD |
Disease | thrombosis, deep vein;GAD |
Disease | Polyarthritis;FunDO |
Disease | multiple sclerosis;GAD |
Disease | hepatitis B;GAD |
Disease | Circulatory system diseases;KEGG DISEASE |
Disease | Mycosis fungoides;FunDO |
Disease | nephropathy in other diseases;GAD |
Disease | endometriosis;GAD |
Disease | silicosis;GAD |
Disease | Leukemia;FunDO |
Disease | pathological myopia;GAD |
Disease | Asthma;GAD |
Disease | asthma, aspirin-intolerant;GAD |
Disease | Cardiac diseases;KEGG DISEASE |
Disease | INFECTION;GAD |
Disease | pulmonary thromboembolism;GAD |
Disease | Hepatitis B;NHGRI |
Disease | METABOLIC;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | diabetes, type 1;GAD |
Disease | bone marrow transplant;GAD |
Disease | Celiac Disease;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | CANCER;GAD |
Disease | Dilated cardiomyopathy (DCM);KEGG DISEASE;H00294 |
Disease | IMMUNE;GAD |
Disease | REPRODUCTION;GAD |
Disease | Urticaria;GAD |
Disease | leukemia, acute lymphoblastic;GAD |
Disease | Beryllium disease, chronic, susceptibility to;OMIM |
Disease | cardiomyopathy;GAD |
Disease | primary biliary cirrhosis;GAD |
Disease | VISION;GAD |
Disease | RENAL;GAD |
|
External Links |
|
Links to Entrez Gene | 3115 |
Links to all GeneRIF Items | 3115 |
Links to iHOP | 3115 |
|
Sequence Information |
|
Nucleotide Sequence |
>3115 : length: 777 atgatggttctgcaggtttctgcggccccccggacagtggctctgacggcgttactgatg gtgctgctcacatctgtggtccagggcagggccactccagagaattaccttttccaggga cggcaggaatgctacgcgtttaatgggacacagcgcttcctggagagatacatctacaac cgggaggagttcgcgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctg gggcggcctgctgcggagtactggaacagccagaaggacatcctggaggagaagcgggca gtgccggacaggatgtgcagacacaactacgagctgggcgggcccatgaccctgcagcgc cgagtccagcctagggtgaatgtttccccctccaagaaggggcccttgcagcaccacaac ctgcttgtctgccacgtgacggatttctacccaggcagcattcaagtccgatggttcctg aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg accttccagatcctggtgatgctggaaatgaccccccagcagggagatgtctacacctgc caagtggagcacaccagcctggatagtcctgtcaccgtggagtggaaggcacagtctgat tctgcccggagtaagacattgacgggagctgggggcttcgtgctggggctcatcatctgt ggagtgggcatcttcatgcacaggaggagcaagaaagttcaacgaggatctgcataa |
Protein Sequence |
>3115 : length: 258 MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC GVGIFMHRRSKKVQRGSA |