| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3162 |
Name | HMOX1 |
Synonym | HMOX1D|HO-1|HSP32|bK286B10;heme oxygenase (decycling) 1;HMOX1;heme oxygenase (decycling) 1 |
Definition | heat shock protein, 32-kD|heme oxygenase 1 |
Position | 22q13.1 |
Gene Type | protein-coding |
|
PAH Type |
Description |
HPH | Upregulation of HMOX1 and production of CO play an inhibiting role in the development of hypoxic pulmonary hypertension. |
PAH | Early macrophage recruitment and alternative activation are critical for the later development of hypoxia-induced pulmonary hypertension. |
PH | Hypoxia inducible factor-1 alpha correlates the expression of heme oxygenase 1 gene in pulmonary arteries of rat with hypoxia-induced pulmonary hypertension. |
PH | Cardioprotective and vasomotor effects of HO activity during acute and chronic hypoxia. |
PH | Increased pulmonary heme oxygenase-1 and delta-aminolevulinate synthase expression in monocrotaline-induced pulmonary hypertension. |
PH | Simvastatin ameliorates established pulmonary hypertension through a heme oxygenase-1 dependent pathway in rats. |
PH | Rapid clearance of circulating haptoglobin from plasma during acute pulmonary embolism in rats results in HMOX1 up-regulation in peripheral blood leukocytes. |
| More detail of all Rat literatures about HMOX1 | |
|
Pathways and Diseases |
|
Pathway | Porphyrin and chlorophyll metabolism;KEGG PATHWAY;hsa00860 |
Pathway | heme degradation;BioCyc;PWY-5874 |
Pathway | HIF-1-alpha transcription factor network;PID Curated;200172 |
Pathway | Metabolism of porphyrins;Reactome;REACT:9431 |
Pathway | il-10 anti-inflammatory signaling pathway;PID BioCarta;100134 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Disease | Malaria, Cerebral;GAD |
Disease | idiopathic recurrent miscarriage.;GAD |
Disease | pregnancy loss, recurrent;GAD |
Disease | Heme oxygenase-1 deficiency;OMIM |
Disease | lymphovascular tumor invasion stomach cancer;GAD |
Disease | Stomach Neoplasms;GAD |
Disease | abdominal aortic aneurysm;GAD |
Disease | oral cancer;GAD |
Disease | inflammatory response;GAD |
Disease | hypertension;GAD |
Disease | lung cancer;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | IMMUNE;GAD |
Disease | kidney transplant;GAD |
Disease | METABOLIC;GAD |
Disease | restenosis;GAD |
Disease | INFECTION;GAD |
Disease | emphysema;GAD |
Disease | diabetes, type 2;GAD |
Disease | heart disease, ischemic;GAD |
Disease | Coronary Artery Disease;GAD |
Disease | arteriovenous fistulas;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | CANCER;GAD |
Disease | melanoma;GAD |
Disease | Pulmonary disease, chronic obstructive, susceptibility to;OMIM |
Disease | REPRODUCTION;GAD |
Disease | restenosis after percutaneous transluminal angioplasty;GAD |
Disease | pneumonia;GAD |
Disease | lung function;GAD |
Disease | aneurysm, abdominal aortic;GAD |
Disease | myocardial infarct;GAD |
Disease | RENAL;GAD |
|
External Links |
|
Links to Entrez Gene | 3162 |
Links to all GeneRIF Items | 3162 |
Links to iHOP | 3162 |
|
Sequence Information |
|
Nucleotide Sequence |
>3162 : length: 867 atggagcgtccgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc accaaggaggtgcacacccaggcagagaatgctgagttcatgaggaactttcagaagggc caggtgacccgagacggcttcaagctggtgatggcctccctgtaccacatctatgtggcc ctggaggaggagattgagcgcaacaaggagagcccagtcttcgcccctgtctacttccca gaagagctgcaccgcaaggctgccctggagcaggacctggccttctggtacgggccccgc tggcaggaggtcatcccctacacaccagccatgcagcgctatgtgaagcggctccacgag gtggggcgcacagagcccgagctgctggtggcccacgcctacacccgctacctgggtgac ctgtctgggggccaggtgctcaaaaagattgcccagaaagccctggacctgcccagctct ggcgagggcctggccttcttcaccttccccaacattgccagtgccaccaagttcaagcag ctctaccgctcccgcatgaactccctggagatgactcccgcagtcaggcagagggtgata gaagaggccaagactgcgttcctgctcaacatccagctctttgaggagttgcaggagctg ctgacccatgacaccaaggaccagagcccctcacgggcaccagggcttcgccagcgggcc agcaacaaagtgcaagattctgcccccgtggagactcccagagggaagcccccactcaac acccgctcccaggctccgcttctccgatgggtccttacactcagctttctggtggcgaca gttgctgtagggctttatgccatgtga |
Protein Sequence |
>3162 : length: 288 MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |