| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3397 |
Name | ID1 |
Synonym | ID|bHLHb24;inhibitor of DNA binding 1, dominant negative helix-loop-helix protein;ID1;inhibitor of DNA binding 1, dominant negative helix-loop-helix protein |
Definition | DNA-binding protein inhibitor ID-1|class B basic helix-loop-helix protein 24|dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)|inhibitor of differentiation 1 |
Position | 20q11 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | Mutations in bone morphogenetic protein type II receptor cause dysregulation of Id gene expression in pulmonary artery smooth muscle cells: implications for familial pulmonary arterial hypertension. |
PAH | Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo. |
PH | Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo. |
| More detail of all Human literatures about ID1 | |
Pathways and Diseases | |
Pathway | Notch-mediated HES/HEY network;PID Curated;200196 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | ALK1 signaling events;PID Curated;200126 |
Disease | Rett syndrome;FunDO |
Disease | Cancer;FunDO |
External Links | |
Links to Entrez Gene | 3397 |
Links to all GeneRIF Items | 3397 |
Links to iHOP | 3397 |
Sequence Information | |
Nucleotide Sequence | >3397 : length: 468 atgaaagtcgccagtggcagcaccgccaccgccgccgcgggccccagctgcgcgctgaag gccggcaagacagcgagcggtgcgggcgaggtggtgcgctgtctgtctgagcagagcgtg gccatctcgcgctgcgccgggggcgccggggcgcgcctgcctgccctgctggacgagcag caggtaaacgtgctgctctacgacatgaacggctgttactcacgcctcaaggagctggtg cccaccctgccccagaaccgcaaggtgagcaaggtggagattctccagcacgtcatcgac tacatcagggaccttcagttggagctgaactcggaatccgaagttggaacccccgggggc cgagggctgccggtccgggctccgctcagcaccctcaacggcgagatcagcgccctgacg gccgaggcggcatgcgttcctgcggacgatcgcatcttgtgtcgctga |
Protein Sequence | >3397 : length: 155 MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |