| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3398 |
Name | ID2 |
Synonym | GIG8|ID2A|ID2H|bHLHb26;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein;ID2;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein |
Definition | DNA-binding protein inhibitor ID-2|DNA-binding protein inhibitor ID2|cell growth-inhibiting gene 8|class B basic helix-loop-helix protein 26|helix-loop-helix protein ID2|inhibitor of differentiation 2 |
Position | 2p25 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Mutations in bone morphogenetic protein type II receptor cause dysregulation of Id gene expression in pulmonary artery smooth muscle cells: implications for familial pulmonary arterial hypertension. |
| More detail of all Human literatures about ID2 | |
|
Pathways and Diseases |
|
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Pathway | HIF-1-alpha transcription factor network;PID Curated;200172 |
Pathway | Validated targets of C-MYC transcriptional activation;PID Curated;200045 |
Disease | Rett syndrome;FunDO |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 3398 |
Links to all GeneRIF Items | 3398 |
Links to iHOP | 3398 |
|
Sequence Information |
|
Nucleotide Sequence |
>3398 : length: 405 atgaaagccttcagtcccgtgaggtccgttaggaaaaacagcctgtcggaccacagcctg ggcatctcccggagcaaaacccctgtggacgacccgatgagcctgctatacaacatgaac gactgctactccaagctcaaggagctggtgcccagcatcccccagaacaagaaggtgagc aagatggaaatcctgcagcacgtcatcgactacatcttggacctgcagatcgccctggac tcgcatcccactattgtcagcctgcatcaccagagacccgggcagaaccaggcgtccagg acgccgctgaccaccctcaacacggatatcagcatcctgtccttgcaggcttctgaattc ccttctgagttaatgtcaaatgacagcaaagcactgtgtggctga |
Protein Sequence |
>3398 : length: 134 MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF PSELMSNDSKALCG |