| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3596 |
Name | IL13 |
Synonym | ALRH|BHR1|IL-13|P600;interleukin 13;IL13;interleukin 13 |
Definition | Bronchial hyperresponsiveness-1 (bronchial asthma)|allergic rhinitis|interleukin-13 |
Position | 5q31 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | Dysregulation of the IL-13 receptor system: a novel pathomechanism in pulmonary arterial hypertension. |
PAH | Dysregulation of the IL-13 receptor system: a novel pathomechanism in pulmonary arterial hypertension. |
PAH | IL-13 contributes to the development of pulmonary hypertension via an IL-13receptor alpha2-arginase 2-dependent pathway. |
| More detail of all Mouse literatures about IL13 | |
Pathways and Diseases | |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Asthma;KEGG PATHWAY;hsa05310 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | gata3 participate in activating the th2 cytokine genes expression;PID BioCarta;100157 |
Pathway | IL12 signaling mediated by STAT4;PID Curated;200197 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Disease | atopy;GAD |
Disease | Atopic asthma;GAD |
Disease | allergic rhinitis;GAD |
Disease | Atopy (total & specific IgE);GAD |
Disease | gastric atrophy;GAD |
Disease | Graves' disease;GAD |
Disease | Periodontitis;FunDO |
Disease | dermatitis and eczema;GAD |
Disease | Graves disease;GAD |
Disease | Mastocytosis, Systemic;GAD |
Disease | malaria, plasmodium falciparum;GAD |
Disease | Respiratory tract disease;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Communicable disease;FunDO |
Disease | immunologically hyper-reactive form of onchocerciasis (sowda);GAD |
Disease | Sinusitis;FunDO |
Disease | BHR;GAD |
Disease | IMMUNE;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Total serum IgE. atopic dermatitis;GAD |
Disease | psoriasis;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | Asthma;GAD |
Disease | Asthma;NHGRI |
Disease | INFECTION;GAD |
Disease | allergic reaction, betalactam;GAD |
Disease | rhinitis;GAD |
Disease | Asthma;KEGG DISEASE;H00079 |
Disease | diabetes, type 1;GAD |
Disease | Psoriasis;NHGRI |
Disease | asthma bronchodilator response IgE lung function;GAD |
Disease | latex allergy;GAD |
Disease | respiratory syncytial virus;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | Total serum IgE;GAD |
Disease | Bronchial hyperreactivity;FunDO |
Disease | herpesvirus, Kaposi sarcoma-associated;GAD |
Disease | Graves' disease;FunDO |
Disease | Adenovirus infection;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | atopic dermatitis;GAD |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | Dermatitis;FunDO |
Disease | Esophagitis;FunDO |
Disease | nephrotic syndrome;GAD |
Disease | Enteritis;FunDO |
Disease | asthma IgE levels;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | onchocerciasis;GAD |
Disease | lung function;GAD |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | Allergic rhinitis, susceptibility to;OMIM |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | Ovary cancer;FunDO |
Disease | serum IgE levels;GAD |
Disease | Hodgkin's disease;FunDO |
Disease | Asthma, susceptibility to;OMIM |
Disease | RENAL;GAD |
External Links | |
Links to Entrez Gene | 3596 |
Links to all GeneRIF Items | 3596 |
Links to iHOP | 3596 |
Sequence Information | |
Nucleotide Sequence | >3596 : length: 441 atgcatccgctcctcaatcctctcctgttggcactgggcctcatggcgcttttgttgacc acggtcattgctctcacttgccttggcggctttgcctccccaggccctgtgcctccctct acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggctccg ctctgcaatggcagcatggtatggagcatcaacctgacagctggcatgtactgtgcagcc ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg agcggattctgcccgcacaaggtctcagctgggcagttttccagcttgcatgtccgagac accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt cgcgagggacagttcaactga |
Protein Sequence | >3596 : length: 146 MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD TKIEVAQFVKDLLLHLKKLFREGQFN |