| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4128 |
Name | MAOA |
Synonym | MAO-A;monoamine oxidase A;MAOA;monoamine oxidase A |
Definition | amine oxidase [flavin-containing] A|monoamine oxidase type A |
Position | Xp11.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension. |
| More detail of all Human literatures about MAOA | |
|
Pathways and Diseases |
|
Pathway | serotonin degradation;BioCyc;PWY-6313 |
Pathway | noradrenaline and adrenaline degradation;BioCyc;PWY-6342 |
Pathway | melatonin degradation II;BioCyc;PWY-6399 |
Pathway | phenylalanine degradation IV (mammalian, via side chain);BioCyc;PWY-6318 |
Pathway | Arginine and proline metabolism;KEGG PATHWAY;hsa00330 |
Pathway | Glycine, serine and threonine metabolism;KEGG PATHWAY;hsa00260 |
Pathway | Biological oxidations;Reactome;REACT:13433 |
Pathway | Tyrosine metabolism;KEGG PATHWAY;hsa00350 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | Phenylalanine metabolism;KEGG PATHWAY;hsa00360 |
Pathway | Synaptic Transmission;Reactome;REACT:13685 |
Pathway | superpathway of melatonin degradation;BioCyc;PWY-6402 |
Pathway | dopamine degradation;BioCyc;PWY6666-2 |
Pathway | Adrenaline and noradrenaline biosynthesis;PANTHER;P00001 |
Pathway | Drug metabolism - cytochrome P450;KEGG PATHWAY;hsa00982 |
Pathway | 5-Hydroxytryptamine degredation;PANTHER;P04372 |
Pathway | Histidine metabolism;KEGG PATHWAY;hsa00340 |
Pathway | Tryptophan metabolism;KEGG PATHWAY;hsa00380 |
Disease | anxiety disorder;GAD |
Disease | cytogenetic studies;GAD |
Disease | ADHD;GAD |
Disease | Neurotic disorder;FunDO |
Disease | depressed suicide;GAD |
Disease | Alzheimer's disease;GAD |
Disease | Tourette syndrome;GAD |
Disease | alcoholism personality disorders;GAD |
Disease | obesity;GAD |
Disease | Breast cancer;FunDO |
Disease | alcohol abuse;GAD |
Disease | Depression;FunDO |
Disease | Down syndrome;FunDO |
Disease | heroin addiction;GAD |
Disease | bipolar affective disorder;GAD |
Disease | neuroticism;GAD |
Disease | personality disorders;GAD |
Disease | sleep disorders;GAD |
Disease | Brunner syndrome;OMIM |
Disease | Sudden infant death syndrome;FunDO |
Disease | depressive disorder, major;GAD |
Disease | Depression, Postpartum;GAD |
Disease | Parkinson's disease;GAD |
Disease | personality;GAD |
Disease | behavioural traits;GAD |
Disease | panic disorder;GAD |
Disease | Smoking behavior;NHGRI |
Disease | restless legs syndrome;GAD |
Disease | alcoholism;GAD |
Disease | Autistic disorder;FunDO |
Disease | depression;GAD |
Disease | METABOLIC;GAD |
Disease | Drug abuse;FunDO |
Disease | PSYCH;GAD |
Disease | Panic disorder;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | body mass obesity;GAD |
Disease | antisocial personality disorder;GAD |
Disease | personality traits;GAD |
Disease | Generalized anxiety disorder;FunDO |
Disease | Fibromyalgia;FunDO |
Disease | pathologic gambling;GAD |
Disease | smoking behavior;GAD |
Disease | attention deficit hyperactivity disorder;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | Bipolar disorder;FunDO |
Disease | depression sleep disorders;GAD |
Disease | attention-deficit hyperactivity disorder;GAD |
Disease | early onset alcoholism/substance abuse.;GAD |
Disease | major depressive disorder;GAD |
Disease | schizophrenia;GAD |
Disease | Obesity;FunDO |
Disease | Anorexia nervosa;FunDO |
Disease | Fibromyalgia;GAD |
Disease | thrombocyte MAO activity;GAD |
Disease | Autism;GAD |
Disease | bipolar disorder;GAD |
Disease | aggression, impulsivity, and central nervous system serotonergic responsivity;GAD |
Disease | Behavior disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 4128 |
Links to all GeneRIF Items | 4128 |
Links to iHOP | 4128 |
|
Sequence Information |
|
Nucleotide Sequence |
>4128 : length: 1584 atggagaatcaagagaaggcgagtatcgcgggccacatgttcgacgtagtcgtgatcgga ggtggcatttcaggactatctgctgccaaactcttgactgaatatggcgttagtgttttg gttttagaagctcgggacagggttggaggaagaacatatactataaggaatgagcatgtt gattacgtagatgttggtggagcttatgtgggaccaacccaaaacagaatcttacgcttg tctaaggagctgggcatagagacttacaaagtgaatgtcagtgagcgtctcgttcaatat gtcaaggggaaaacatatccatttcggggcgcctttccaccagtatggaatcccattgca tatttggattacaataatctgtggaggacaatagataacatggggaaggagattccaact gatgcaccctgggaggctcaacatgctgacaaatgggacaaaatgaccatgaaagagctc attgacaaaatctgctggacaaagactgctaggcggtttgcttatctttttgtgaatatc aatgtgacctctgagcctcacgaagtgtctgccctgtggttcttgtggtatgtgaagcag tgcgggggcaccactcggatattctctgtcaccaatggtggccaggaacggaagtttgta ggtggatctggtcaagtgagcgaacggataatggacctcctcggagaccaagtgaagctg aaccatcctgtcactcacgttgaccagtcaagtgacaacatcatcatagagacgctgaac catgaacattatgagtgcaaatacgtaattaatgcgatccctccgaccttgactgccaag attcacttcagaccagagcttccagcagagagaaaccagttaattcagcggcttccaatg ggagctgtcattaagtgcatgatgtattacaaggaggccttctggaagaagaaggattac tgtggctgcatgatcattgaagatgaagatgctccaatttcaataaccttggatgacacc aagccagatgggtcactgcctgccatcatgggcttcattcttgcccggaaagctgatcga cttgctaagctacataaggaaataaggaagaagaaaatctgtgagctctatgccaaagtg ctgggatcccaagaagctttacatccagtgcattatgaagagaagaactggtgtgaggag cagtactctgggggctgctacacggcctacttccctcctgggatcatgactcaatatgga agggtgattcgtcaacccgtgggcaggattttctttgcgggcacagagactgccacaaag tggagcggctacatggaaggggcagttgaggctggagaacgagcagctagggaggtctta aatggtctcgggaaggtgaccgagaaagatatctgggtacaagaacctgaatcaaaggac gttccagcggtagaaatcacccacaccttctgggaaaggaacctgccctctgtttctggc ctgctgaagatcattggattttccacatcagtaactgccctggggtttgtgctgtacaaa tacaagctcctgccacggtcttga |
Protein Sequence |
>4128 : length: 527 MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS |