| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4312 |
Name | MMP1 |
Synonym | CLG|CLGN;matrix metallopeptidase 1 (interstitial collagenase);MMP1;matrix metallopeptidase 1 (interstitial collagenase) |
Definition | fibroblast collagenase|interstitial collagenase|matrix metalloprotease 1|matrix metalloproteinase 1 |
Position | 11q22.3 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "Deciphering the ""matrix"" in pulmonary vascular remodelling." |
| More detail of all Human literatures about MMP1 | |
|
Pathways and Diseases |
|
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Basigin interactions;PID Reactome;500308 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Endothelins;PID Curated;200004 |
Pathway | Alzheimer disease-presenilin pathway;PANTHER;P00004 |
Pathway | Syndecan-1-mediated signaling events;PID Curated;200134 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | PPAR signaling pathway;KEGG PATHWAY;hsa03320 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Plasminogen activating cascade;PANTHER;P00050 |
Pathway | Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044 |
Disease | hypertension, pregnancy induced;GAD |
Disease | Eclampsia;GAD |
Disease | cholangitis, sclerosing;GAD |
Disease | oral submucous fibrosis;GAD |
Disease | endometriosis;GAD |
Disease | Airway Obstruction;GAD |
Disease | COPD, rate of decline of lung function in;OMIM |
Disease | conventional renal cell carcinoma;GAD |
Disease | kidney cancer;GAD |
Disease | Periodontitis;FunDO |
Disease | cancer;GAD |
Disease | Chronic Periodontitis;GAD |
Disease | Cancer;FunDO |
Disease | Polyarthritis;FunDO |
Disease | Alzheimer's disease dementia, vascular;GAD |
Disease | bladder cancer;GAD |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | oral cancer;GAD |
Disease | Emphysema;FunDO |
Disease | Epidermolysis bullosa dystrophica, autosomal recessive, modifier of;OMIM |
Disease | lung cancer;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | IMMUNE;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Body mass index;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | brain cancer;GAD |
Disease | Polycystic ovary syndrome;FunDO |
Disease | Choriocarcinoma;KEGG DISEASE;H00028 |
Disease | Asthma;GAD |
Disease | Dental plaque;FunDO |
Disease | Ptosis;FunDO |
Disease | periodontitis;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | colorectal cancer;GAD |
Disease | Bone Mineral Density;GAD |
Disease | METABOLIC;GAD |
Disease | bone density;GAD |
Disease | Synovitis;FunDO |
Disease | Tuberculosis;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | ulcerative colitis;GAD |
Disease | preeclampsia;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Stroke;GAD |
Disease | head and neck cancer;GAD |
Disease | ovarian cancer;GAD |
Disease | CANCER;GAD |
Disease | Heart failure;FunDO |
Disease | Malaria;FunDO |
Disease | Lyme disease;FunDO |
Disease | osseointegrated implant failure;GAD |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Endometriosis;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | REPRODUCTION;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | carotid artery stenosis;GAD |
Disease | Enteritis;FunDO |
Disease | breast cancer;GAD |
Disease | nasopharyngeal cancer;GAD |
Disease | lung function;GAD |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | coronary heart disease;GAD |
Disease | polycystic ovary syndrome;GAD |
Disease | adenomyosis;GAD |
Disease | Connective tissue disease;FunDO |
Disease | Atherosclerosis;FunDO |
Disease | cervical cancer;GAD |
Disease | liver disease, chronic;GAD |
Disease | Gingival overgrowth;FunDO |
|
External Links |
|
Links to Entrez Gene | 4312 |
Links to all GeneRIF Items | 4312 |
Links to iHOP | 4312 |
|
Sequence Information |
|
Nucleotide Sequence |
>4312 : length: 1212 atgcaggaattctttgggctgaaagtgactgggaaaccagatgctgaaaccctgaaggtg atgaagcagcccagatgtggagtgcctgatgtggctcagtttgtcctcactgaggggaac cctcgctgggagcaaacacatctgacctacaggattgaaaattacacgccagatttgcca agagcagatgtggaccatgccattgagaaagccttccaactctggagtaatgtcacacct ctgacattcaccaaggtctctgagggtcaagcagacatcatgatatcttttgtcagggga gatcatcgggacaactctccttttgatggacctggaggaaatcttgctcatgcttttcaa ccaggcccaggtattggaggggatgctcattttgatgaagatgaaaggtggaccaacaat ttcagagagtacaacttacatcgtgttgcagctcatgaactcggccattctcttggactc tcccattctactgatatcggggctttgatgtaccctagctacaccttcagtggtgatgtt cagctagctcaggatgacattgatggcatccaagccatatatggacgttcccaaaatcct gtccagcccatcggcccacaaaccccaaaagcgtgtgacagtaagctaacctttgatgct ataactacgattcggggagaagtgatgttctttaaagacagattctacatgcgcacaaat cccttctacccggaagttgagctcaatttcatttctgttttctggccacaactgccaaat gggcttgaagctgcttacgaatttgccgacagagatgaagtccggtttttcaaagggaat aagtactgggctgttcagggacagaatgtgctacacggataccccaaggacatctacagc tcctttggcttccctagaactgtgaagcatatcgatgctgctctttctgaggaaaacact ggaaaaacctacttctttgttgctaacaaatactggaggtatgatgaatataaacgatct atggatccaggttatcccaaaatgatagcacatgactttcctggaattggccacaaagtt gatgcagttttcatgaaagatggatttttctatttctttcatggaacaagacaatacaaa tttgatcctaaaacgaagagaattttgactctccagaaagctaatagctggttcaactgc aggaaaaattga |
Protein Sequence |
>4312 : length: 403 MQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLP RADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQ PGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDV QLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTN PFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYS SFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKV DAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |