| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4879 |
Name | NPPB |
Synonym | BNP;natriuretic peptide B;NPPB;natriuretic peptide B |
Definition | brain type natriuretic peptide|gamma-brain natriuretic peptide|natriuretic peptide precursor B|natriuretic peptides B|natriuretic protein |
Position | 1p36.2 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Characterization of brain natriuretic peptide in long-term follow-up of pulmonary arterial hypertension. |
PAH | Brain natriuretic peptide as noninvasive marker of the severity of right ventricular dysfunction in chronic thromboembolic pulmonary hypertension. |
PAH | N-terminal-pro-B type natriuretic peptide as a useful tool to evaluate pulmonary hypertension and cardiac function in CDH infants. |
PAH | N-terminal natriuretic peptide and ventilation-perfusion lung scan in sickle cell disease and thalassemia patients with pulmonary hypertension. |
PAH | Significance of plasma NT-proBNP levels as a biomarker in the assessment of cardiac involvement and pulmonary hypertension in patients with sarcoidosis. |
PAH | Increased cardiac release of BNP an NT-proBNP is shown in patients with pulmonary arterial hypertension. |
PAH | "In pediatric pulmonary arterial hypertension, BNP and NTProBNP are strongly correlated and predict changes in clinical variables and hemodynamics." |
| More detail of all Human literatures about NPPB | |
|
Pathways and Diseases |
|
Pathway | alk in cardiac myocytes;PID BioCarta;100244 |
Disease | diabetes, type 2;GAD |
Disease | hypertension;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | METABOLIC;GAD |
Disease | low bone-mineral density and rapid postmenopausal bone loss;GAD |
Disease | systolic blood pressure;GAD |
|
External Links |
|
Links to Entrez Gene | 4879 |
Links to all GeneRIF Items | 4879 |
Links to iHOP | 4879 |
|
Sequence Information |
|
Nucleotide Sequence |
>4879 : length: 405 atggatccccagacagcaccttcccgggcgctcctgctcctgctcttcttgcatctggct ttcctgggaggtcgttcccacccgctgggcagccccggttcagcctcggacttggaaacg tccgggttacaggagcagcgcaaccatttgcagggcaaactgtcggagctgcaggtggag cagacatccctggagcccctccaggagagcccccgtcccacaggtgtctggaagtcccgg gaggtagccaccgagggcatccgtgggcaccgcaaaatggtcctctacaccctgcgggca ccacgaagccccaagatggtgcaagggtctggctgctttgggaggaagatggaccggatc agctcctccagtggcctgggctgcaaagtgctgaggcggcattaa |
Protein Sequence |
>4879 : length: 134 MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI SSSSGLGCKVLRRH |