| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 51188 |
Name | SS18L2 |
Synonym | KIAA-iso;synovial sarcoma translocation gene on chromosome 18-like 2;SS18L2;synovial sarcoma translocation gene on chromosome 18-like 2 |
Definition | SS18-like protein 2|SYT homolog 2 |
Position | 3p21 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "We observed linkage evidence in four regions: 3q22 ([median log of the odds (LOD) = 3.43]), 3p12 (median LOD) = 2.35), 2p22 (median LOD = 2.21), and 13q21 (median LOD = 2.09). When used in conjunction with the non-parametric bootstrap, our approach yields high-resolution to identify candidate gene regions containing putative BMPR2-interacting genes. Imputation of the disease model by LOD-score maximization indicates that the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically." |
| More detail of all Human literatures about SS18L2 | |
External Links | |
Links to Entrez Gene | 51188 |
Links to all GeneRIF Items | 51188 |
Links to iHOP | 51188 |
Sequence Information | |
Nucleotide Sequence | >51188 : length: 234 atgtcggtggccttcgtaccggactggctgaggggcaaggcggaagtcaatcaagagact atccagcggctccttgaggagaatgaccagctgatccgctgtattgtggagtatcagaac aagggccgcgggaacgagtgcgtgcagtaccagcatgtgttacatagaaatctcatttat ttggctaccattgcagatgccagtccaaccagcacttcaaaagcaatggaataa |
Protein Sequence | >51188 : length: 77 MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIY LATIADASPTSTSKAME |