| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5468 |
Name | PPARG |
Synonym | CIMT1|GLM1|NR1C3|PPARG1|PPARG2|PPARgamma;peroxisome proliferator-activated receptor gamma;PPARG;peroxisome proliferator-activated receptor gamma |
Definition | PPAR gamma|PPAR-gamma|nuclear receptor subfamily 1 group C member 3|peroxisome proliferator-activated nuclear receptor gamma variant 1|peroxisome proliferator-activated receptor gamma 1 |
Position | 3p25 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Peroxisome proliferator-activated receptor gamma (PPARgamma) expression is decreased in pulmonary hypertension and affects endothelial cell growth. |
PAH | The Role of PPARgamma in pulmonary vascular disease. |
PAH | An antiproliferative BMP-2/PPARgamma/apoE axis in human and murine SMCs and its role in pulmonary hypertension. |
PAH | Peroxisome proliferator-activated receptor gamma: innate protection from excessive fibrogenesis and potential therapeutic target in systemic sclerosis. |
PAH | "These results demonstrated the beneficial effect of PPARgamma on 5-HT2BR-mediated vasocontraction, providing a new mechanism for the potential use of PPARgamma agonists in PAH." |
PH | An antiproliferative BMP-2/PPARgamma/apoE axis in human and murine SMCs and its role in pulmonary hypertension. |
PH | Rosiglitazone attenuates chronic hypoxia-induced pulmonary hypertension in a mouse model. |
PH | Tie2-mediated loss of peroxisome proliferator-activated receptor-gamma in mice causes PDGF receptor-beta-dependent pulmonary arterial muscularization. |
| More detail of all Human literatures about PPARG | |
|
Pathways and Diseases |
|
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | role of ppar-gamma coactivators in obesity and thermogenesis;PID BioCarta;100065 |
Pathway | basic mechanism of action of ppara pparb(d) and pparg and effects on gene expression;PID BioCarta;100064 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Signaling events mediated by HDAC Class I;PID Curated;200070 |
Pathway | visceral fat deposits and the metabolic syndrome;PID BioCarta;100004 |
Pathway | Noncanonical Wnt signaling pathway;PID Curated;200016 |
Pathway | Gene Expression;Reactome;REACT:71 |
Pathway | PPAR signaling pathway;KEGG PATHWAY;hsa03320 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Thyroid cancer;KEGG PATHWAY;hsa05216 |
Disease | Thyroid cancer;KEGG DISEASE;H00032 |
Disease | Type 2 diabetes;NHGRI |
Disease | Body Weight;GAD |
Disease | increased antilipolytic insulin sensitivity;GAD |
Disease | metabolic syndrome;GAD |
Disease | Obesity, severe;OMIM |
Disease | cardiovascular;GAD |
Disease | lipids;GAD |
Disease | cholesterol, HDL;GAD |
Disease | Diabetes, type 2;OMIM |
Disease | exercise-mediated changes of insulin resistance;GAD |
Disease | edema;GAD |
Disease | obesity;GAD |
Disease | triglycerides;GAD |
Disease | Increased plasma concentrations of total cholesterol;GAD |
Disease | Diabetes;KEGG DISEASE |
Disease | Essential Hypertension;GAD |
Disease | oxidized low-density lipoprotein and cardiolipin autoantibodies;GAD |
Disease | Genetic disorders;KEGG DISEASE |
Disease | Insulin resistance, severe, digenic;OMIM |
Disease | IMMUNE;GAD |
Disease | waist circumference;GAD |
Disease | glucose;GAD |
Disease | Cancers of endocrine organs;KEGG DISEASE |
Disease | Familial partial lipodystrophy;KEGG DISEASE;H00420 |
Disease | PHARMACOGENOMIC;GAD |
Disease | birth weight preterm delivery;GAD |
Disease | body mass energy metabolism;GAD |
Disease | METABOLIC;GAD |
Disease | LDL-cholesterol;GAD |
Disease | Carotid intimal medial thickness 1;OMIM |
Disease | Lipodystrophy, familial partial, type 3;OMIM |
Disease | colorectal cancer;GAD |
Disease | Bone Mineral Density;GAD |
Disease | Insulin Resistance;GAD |
Disease | type 2 diabetes;GAD |
Disease | diabetes, type 2;GAD |
Disease | higher body mass index;GAD |
Disease | diabetes, type 1;GAD |
Disease | Coronary Artery Disease;GAD |
Disease | larger body mass;GAD |
Disease | Peripheral Vascular Diseases;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | insulin;GAD |
Disease | Other genetic disorders;KEGG DISEASE |
Disease | NORMALVARIATION;GAD |
Disease | higher levels of serum leptin;GAD |
Disease | cholesterol, LDL;GAD |
Disease | lower lipoprotein lipase activity;GAD |
Disease | cardiovascular risk factors;GAD |
Disease | Obesity, resistance to;OMIM |
Disease | height;GAD |
Disease | atherosclerosis, generalized;GAD |
Disease | hyperglycemia insulin;GAD |
Disease | Glioblastoma, susceptibility to;OMIM |
Disease | REPRODUCTION;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | body mass;GAD |
Disease | Hypertension/complications*;GAD |
Disease | CANCER;GAD |
Disease | HDL cholesterol/ BMI;GAD |
Disease | Obesity, Morbid;GAD |
Disease | Type II diabetes mellitus;KEGG DISEASE;H00409 |
Disease | cholesterol, total;GAD |
Disease | insulin sensitivity and body composition;GAD |
Disease | myocardial infarct;GAD |
|
External Links |
|
Links to Entrez Gene | 5468 |
Links to all GeneRIF Items | 5468 |
Links to iHOP | 5468 |
|
Sequence Information |
|
Nucleotide Sequence |
>5468 : length: 1434 atgaccatggttgacacagagatgccattctggcccaccaactttgggatcagctccgtg gatctctccgtaatggaagaccactcccactcctttgatatcaagcccttcactactgtt gacttctccagcatttctactccacattacgaagacattccattcacaagaacagatcca gtggttgcagattacaagtatgacctgaaacttcaagagtaccaaagtgcaatcaaagtg gagcctgcatctccaccttattattctgagaagactcagctctacaataagcctcatgaa gagccttccaactccctcatggcaattgaatgtcgtgtctgtggagataaagcttctgga tttcactatggagttcatgcttgtgaaggatgcaagggtttcttccggagaacaatcaga ttgaagcttatctatgacagatgtgatcttaactgtcggatccacaaaaaaagtagaaat aaatgtcagtactgtcggtttcagaaatgccttgcagtggggatgtctcataatgccatc aggtttgggcggatgccacaggccgagaaggagaagctgttggcggagatctccagtgat atcgaccagctgaatccagagtccgctgacctccgggccctggcaaaacatttgtatgac tcatacataaagtccttcccgctgaccaaagcaaaggcgagggcgatcttgacaggaaag acaacagacaaatcaccattcgttatctatgacatgaattccttaatgatgggagaagat aaaatcaagttcaaacacatcacccccctgcaggagcagagcaaagaggtggccatccgc atctttcagggctgccagtttcgctccgtggaggctgtgcaggagatcacagagtatgcc aaaagcattcctggttttgtaaatcttgacttgaacgaccaagtaactctcctcaaatat ggagtccacgagatcatttacacaatgctggcctccttgatgaataaagatggggttctc atatccgagggccaaggcttcatgacaagggagtttctaaagagcctgcgaaagcctttt ggtgactttatggagcccaagtttgagtttgctgtgaagttcaatgcactggaattagat gacagcgacttggcaatatttattgctgtcattattctcagtggagaccgcccaggtttg ctgaatgtgaagcccattgaagacattcaagacaacctgctacaagccctggagctccag ctgaagctgaaccaccctgagtcctcacagctgtttgccaagctgctccagaaaatgaca gacctcagacagattgtcacggaacacgtgcagctactgcaggtgatcaagaagacggag acagacatgagtcttcacccgctcctgcaggagatctacaaggacttgtactag |
Protein Sequence |
>5468 : length: 477 MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDP VVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASG FHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAI RFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGK TTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYA KSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPF GDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY |