| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 57060 |
Name | PCBP4 |
Synonym | CBP|LIP4|MCG10;poly(rC) binding protein 4;PCBP4;poly(rC) binding protein 4 |
Definition | LYST-interacting protein|RNA binding protein MCG10|alpha-CP4|poly(rC)-binding protein 4 |
Position | 3p21 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "We observed linkage evidence in four regions: 3q22 ([median log of the odds (LOD) = 3.43]), 3p12 (median LOD) = 2.35), 2p22 (median LOD = 2.21), and 13q21 (median LOD = 2.09). When used in conjunction with the non-parametric bootstrap, our approach yields high-resolution to identify candidate gene regions containing putative BMPR2-interacting genes. Imputation of the disease model by LOD-score maximization indicates that the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically." |
| More detail of all Human literatures about PCBP4 | |
|
Pathways and Diseases |
|
Pathway | Direct p53 effectors;PID Curated;200101 |
Disease | Lung cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 57060 |
Links to all GeneRIF Items | 57060 |
Links to iHOP | 57060 |
|
Sequence Information |
|
Nucleotide Sequence |
>57060 : length: 1212 atgagcggctcggacgggggactggaggaggagccagagctcagcatcaccctcacgctg cggatgctgatgcacgggaaggaagtgggcagcatcatcgggaagaagggcgagactgta aagcgaatccgggagcagagcagtgcccggatcaccatctccgagggctcctgccctgaa cgcatcaccaccatcaccgggtctacagcagctgtcttccatgcagtctccatgattgct ttcaaactggatgaggacctttgtgctgctcctgcaaatggtggaaatgtctccaggcct ccagtgaccctgcgccttgtcatccctgccagtcagtgtggctcactgattgggaaggct ggcaccaagatcaaggagatccgagagactacgggtgcccaggtacaggtggcaggggac ctgctccccaactccacagagcgagctgttacggtatctggggtgcctgatgccatcatc ctgtgtgtgcgccagatctgcgctgttatcctggagtccccacccaaaggagccactatc ccctaccatccgagcctctccctaggtactgttcttctctctgccaaccagggcttctct gtccagggtcagtatggggctgtgaccccagctgaggtcaccaagctccagcagctctca agccatgcggtcccctttgccacacccagcgtggtgccaggactggatcccggcacacag accagctcacaggagttcttggttcccaacgatttgattggctgtgtgatcgggcgccag ggcagcaagatcagcgagatccggcagatgtcaggggcacatatcaagatcgggaaccaa gcagagggcgctggggagcggcatgtcaccatcactggctctccggtctccatcgccctg gcccagtacctcatcactgcctgtctagagacggccaagtctacctctggggggacgccc agctcggcccccgcagacctgcctgcccccttctcgccacccctgacggccctgcccaca gctccccctggcctgctgggcacaccctatgccatctccctctccaacttcatcggcctc aagcccatgcccttcttggctttaccacctgcttccccagggccgccgccgggcttggcg gcctacactgccaagatggcagcagctaatgggagcaagaaggctgagcggcagaaattc tccccctactga |
Protein Sequence |
>57060 : length: 403 MSGSDGGLEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPE RITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSLIGKA GTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATI PYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQ TSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIAL AQYLITACLETAKSTSGGTPSSAPADLPAPFSPPLTALPTAPPGLLGTPYAISLSNFIGL KPMPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY |