| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 6275 |
Name | S100A4 |
Synonym | 18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98;S100 calcium binding protein A4;S100A4;S100 calcium binding protein A4 |
Definition | S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|fibroblast-specific protein-1|leukemia multidrug resistance associated protein|malignant transformation suppression 1|placental calcium-binding protein|pr |
Position | 1q21 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | S100A4/Mts1 over-expression combined with female gender is permissive to the development of experimental pulmonary arterial hypertension in mice. |
PAH | S100A4/Mts1 over-expression combined with female gender is permissive to the development of experimental pulmonary arterial hypertension in mice. |
PAH | "Experimental studies attribute the manifestation of pulmonary vascular pathology in S100A4-overexpressing female mice to 17?-estradiol induction of receptor for advanced glycosylation end-products (RAGE), the S100A4 receptor." |
| More detail of all Mouse literatures about S100A4 | |
External Links | |
Links to Entrez Gene | 6275 |
Links to all GeneRIF Items | 6275 |
Links to iHOP | 6275 |
Sequence Information | |
Nucleotide Sequence | >6275 : length: 306 atggcgtgccctctggagaaggccctggatgtgatggtgtccaccttccacaagtactcg ggcaaagagggtgacaagttcaagctcaacaagtcagaactaaaggagctgctgacccgg gagctgcccagcttcttggggaaaaggacagatgaagctgctttccagaagctgatgagc aacttggacagcaacagggacaacgaggtggacttccaagagtactgtgtcttcctgtcc tgcatcgccatgatgtgtaacgaattctttgaaggcttcccagataagcagcccaggaag aaatga |
Protein Sequence | >6275 : length: 101 MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |