| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 6387 |
Name | CXCL12 |
Synonym | IRH|PBSF|SCYB12|SDF1|SDF1A|SDF1B|TLSF|TPAR1;chemokine (C-X-C motif) ligand 12;CXCL12;chemokine (C-X-C motif) ligand 12 |
Definition | intercrine reduced in hepatomas|pre-B cell growth-stimulating factor|stromal cell-derived factor 1 |
Position | 10q11.1 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | Association between a stromal cell-derived factor 1 (SDF-1/CXCL12) gene polymorphism and microvascular disease in systemic sclerosis. |
PAH | Elevated circulating stromal-derived factor-1 levels in sickle cell disease. |
| More detail of all Human literatures about CXCL12 | |
Pathways and Diseases | |
Pathway | pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214 |
Pathway | cxcr4 signaling pathway;PID BioCarta;100192 |
Pathway | Syndecan-4-mediated signaling events;PID Curated;200115 |
Pathway | Axon guidance mediated by Slit/Robo;PANTHER;P00008 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | HIF-1-alpha transcription factor network;PID Curated;200172 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | Axon guidance;KEGG PATHWAY;hsa04360 |
Pathway | CXCR4-mediated signaling events;PID Curated;200083 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | Chemokine receptors bind chemokines;PID Reactome;500406 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Disease | Lupus erythematosus;FunDO |
Disease | leukemia, myeloid;GAD |
Disease | HEMATOLOGICAL;GAD |
Disease | Coronary heart disease;NHGRI |
Disease | Cancer;FunDO |
Disease | Polyarthritis;FunDO |
Disease | Oral cancer;FunDO |
Disease | HIV infection;FunDO |
Disease | Leukoencephalopathy;FunDO |
Disease | AIDS, resistance to;OMIM |
Disease | Immunologic deficiency syndrome;FunDO |
Disease | IMMUNE;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Pulmonary fibrosis;FunDO |
Disease | HIV;GAD |
Disease | INFECTION;GAD |
Disease | increased perinatal immunodeficiency virus type 1 transmission;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | diabetes, type 1;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | CANCER;GAD |
Disease | Coronary Disease;GAD |
Disease | myocardial infarction (early onset);GAD |
Disease | Behcet syndrome;FunDO |
Disease | Wiskott-Aldrich syndrome;FunDO |
Disease | hematopoietic progenitor cells, mobilization of;GAD |
Disease | Atherosclerosis;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Myocardial infarction (early onset);NHGRI |
Disease | Arthritis;FunDO |
External Links | |
Links to Entrez Gene | 6387 |
Links to all GeneRIF Items | 6387 |
Links to iHOP | 6387 |
Sequence Information | |
Nucleotide Sequence | >6387 : length: 282 atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag gagtacctggagaaagctttaaacaagaggttcaagatgtga |
Protein Sequence | >6387 : length: 93 MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |