| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 6988 |
Name | TCTA |
Synonym | -;T-cell leukemia translocation altered;TCTA;T-cell leukemia translocation altered |
Definition | T-cell leukemia translocation-altered gene protein|T-cell leukemia translocation-associated gene protein |
Position | 3p21 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "We observed linkage evidence in four regions: 3q22 ([median log of the odds (LOD) = 3.43]), 3p12 (median LOD) = 2.35), 2p22 (median LOD = 2.21), and 13q21 (median LOD = 2.09). When used in conjunction with the non-parametric bootstrap, our approach yields high-resolution to identify candidate gene regions containing putative BMPR2-interacting genes. Imputation of the disease model by LOD-score maximization indicates that the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically." |
| More detail of all Human literatures about TCTA | |
External Links | |
Links to Entrez Gene | 6988 |
Links to all GeneRIF Items | 6988 |
Links to iHOP | 6988 |
Sequence Information | |
Nucleotide Sequence | >6988 : length: 312 atggcggagtcctggtctgggcaggccttgcaggctctgccggccacggtgctgggcgcg ctgggcagcgagttcttgcgggagtgggaggcgcaggacatgcgcgtgaccctcttcaag ctgctgctgctgtggttggtgttaagtctcctgggcatccagctggcgtgggggttctac gggaatacagtgaccgggttgtatcaccgtccaggtctgggtggtcagaatggatccacg cctgatggctccacgcatttcccttcgtgggaaatggcagcaaacgaacctctcaaaacc cacagagaataa |
Protein Sequence | >6988 : length: 103 MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFY GNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE |