| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 6993 |
Name | DYNLT1 |
Synonym | CW-1|TCTEL1|tctex-1;dynein, light chain, Tctex-type 1;DYNLT1;dynein, light chain, Tctex-type 1 |
Definition | T-complex testis-specific protein 1 homolog|dynein light chain Tctex-type 1|t-complex-associated-testis-expressed 1-like 1 |
Position | 6q25.2-q25.3 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "Functional interaction between BMPR-II and Tctex-1, a light chain of Dynein, is isoform-specific and disrupted by mutations underlying primary pulmonary hypertension." |
| More detail of all Human literatures about DYNLT1 | |
Pathways and Diseases | |
Pathway | Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128 |
Pathway | Lissencephaly gene (LIS1) in neuronal migration and development;PID Curated;200114 |
External Links | |
Links to Entrez Gene | 6993 |
Links to all GeneRIF Items | 6993 |
Links to iHOP | 6993 |
Sequence Information | |
Nucleotide Sequence | >6993 : length: 342 atggaagactaccaggctgcggaggagactgcttttgttgttgatgaagtgagcaacatt gtaaaagaggctatagaaagcgcaattggtggtaacgcttatcaacacagcaaagtgaac cagtggaccacaaatgtagtagaacaaactttaagccaactcaccaagctgggaaaacca tttaaatacatcgtgacctgtgtaattatgcagaagaatggagctggattacacacagca agttcctgcttctgggacagctctactgacgggagctgcactgtgcgatgggagaataag accatgtactgcatcgtcagtgccttcggactgtctatttga |
Protein Sequence | >6993 : length: 113 MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI |