| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7422 |
Name | VEGFA |
Synonym | MVCD1|VEGF|VPF;vascular endothelial growth factor A;VEGFA;vascular endothelial growth factor A |
Definition | vascular permeability factor |
Position | 6p12 |
Gene Type | protein-coding |
|
PAH Type |
Description |
HPH | ET-1 and VEGF play important roles in the pathogenesis of hypoxic pulmonary hypertension. |
HPH | VEGF and ET-1 participate the muscularization of pulmonary vessels during hypoxia and play an important role in the process of hypoxic pulmonary hypertension in rats. |
HPH | Hypoxic pulmonary hypertension is closely associated with increased expression of HIF-1alpha and VEGF in high altitide areas. |
PAH | [Different expression and significance of VEGF and PCNA in aorta and pulmonary artery smooth muscle cells of rats with hypoxia pulmonary hypertension]. |
PAH | "Vascular endothelial growth factor, lipoporotein-associated phospholipase A2, sP-selectin and antiphospholipid antibodies, biological markers with prognostic value in pulmonary hypertension associated with chronic obstructive pulmonary disease and systemic lupus erithematosus." |
PAH | Serum VEGF levels are related to the presence of pulmonary arterial hypertension in systemic sclerosis. |
PAH | "Expression of HIF-1 alpha, VEGF and EPO in peripheral blood from patients with two cardiac abnormalities associated with hypoxia." |
| More detail of all Rat literatures about VEGFA | |
|
Pathways and Diseases |
|
Pathway | S1P3 pathway;PID Curated;200035 |
Pathway | Neurophilin interactions with VEGF and VEGFR;PID Reactome;500650 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Signaling events mediated by TCPTP;PID Curated;200065 |
Pathway | HIF-1-alpha transcription factor network;PID Curated;200172 |
Pathway | VEGFR1 specific signals;PID Curated;200151 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | VEGF signaling pathway;KEGG PATHWAY;hsa04370 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | S1P1 pathway;PID Curated;200071 |
Pathway | HIF-2-alpha transcription factor network;PID Curated;200030 |
Pathway | Glypican 1 network;PID Curated;200021 |
Pathway | Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161 |
Pathway | VEGF signaling pathway;PANTHER;P00056 |
Pathway | hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145 |
Pathway | Angiogenesis;PANTHER;P00005 |
Pathway | mTOR signaling pathway;KEGG PATHWAY;hsa04150 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Renal cell carcinoma;KEGG PATHWAY;hsa05211 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | actions of nitric oxide in the heart;PID BioCarta;100094 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Integrins in angiogenesis;PID Curated;200109 |
Pathway | Signaling by VEGF;Reactome;REACT:12529 |
Pathway | vegf hypoxia and angiogenesis;PID BioCarta;100006 |
Disease | Microvascular complications of diabetes 1;OMIM |
Disease | Cancer;FunDO |
Disease | longevity;GAD |
Disease | IMMUNE;GAD |
Disease | endometriosis;GAD |
Disease | kawasaki disease;GAD |
Disease | Pre-Eclampsia;GAD |
Disease | Neovascularization, Pathologic;GAD |
Disease | Malaria;FunDO |
Disease | diabetes, type 1 diabetic nephropathy;GAD |
Disease | sarcoidosis;GAD |
Disease | diabetes, type 2 retinopathy, diabetic;GAD |
Disease | Macular Degeneration;GAD |
Disease | myocardial infarct;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Polyneuropathy;FunDO |
Disease | Waist-hip ratio;NHGRI |
Disease | pregnancy loss, recurrent;GAD |
Disease | urinary calculus;GAD |
Disease | kidney cancer;GAD |
Disease | Stomach Neoplasms;GAD |
Disease | vascular endothelial growth factor levels;GAD |
Disease | nephropathy, IgA;GAD |
Disease | oral cancer;GAD |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | atherosclerosis, coronary;GAD |
Disease | prostate cancer;GAD |
Disease | Systemic infection;FunDO |
Disease | diabetes, type 1;GAD |
Disease | vascular endothelial growth factor;GAD |
Disease | Heart Septal Defects, Ventricular;GAD |
Disease | cutaneous malignant melanoma;GAD |
Disease | acute renal allograft rejection;GAD |
Disease | CANCER;GAD |
Disease | diabetic nephropathy;GAD |
Disease | Carcinoma, Squamous Cell;GAD |
Disease | Pterygium;GAD |
Disease | benzene haematotoxicity;GAD |
Disease | Type 2 diabetes;NHGRI |
Disease | Macular degeneration;FunDO |
Disease | AGING;GAD |
Disease | ALS/amyotrophic lateral sclerosis;GAD |
Disease | hemodialysis;GAD |
Disease | type 2 diabetes;GAD |
Disease | Henoch-Schonlein purpura;GAD |
Disease | psoriasis;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | METABOLIC;GAD |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | Diabetic Retinopathy in Type 2 Diabetes;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | retinopathy, diabetic;GAD |
Disease | colorectal cancer;GAD |
Disease | retinopathy;GAD |
Disease | Capillaries disease;FunDO |
Disease | diabetes, type 2;GAD |
Disease | 18F-fluorodeoxyglucose uptake;GAD |
Disease | macular edema;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | renal disease, end stage vascular endothelial growth factor;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | REPRODUCTION;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | breast cancer;GAD |
Disease | Leiomyoma;GAD |
Disease | Obesity;FunDO |
Disease | coronary artery bypass;GAD |
Disease | ovarian cancer;GAD |
Disease | stomach cancer;GAD |
Disease | Retinopathy of Prematurity;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | Gastric cancer;KEGG DISEASE;H00018 |
Disease | preterm delivery;GAD |
Disease | Alzheimer's disease;GAD |
Disease | stomach cancer vascular endothelial growth factor levels;GAD |
Disease | Chronic kidney disease;NHGRI |
Disease | bladder cancer;GAD |
Disease | Leukoencephalopathy;FunDO |
Disease | Mouth Neoplasms;GAD |
Disease | heart anomalies, congenital;GAD |
Disease | SIDS/sudden infant death syndrome;GAD |
Disease | lung cancer;GAD |
Disease | VISION;GAD |
Disease | nephropathy in other diseases;GAD |
Disease | Peptic ulcer;FunDO |
Disease | Heart Failure;GAD |
Disease | Ventricular Septal Defects;GAD |
Disease | Femur Head Necrosis;GAD |
Disease | Uterine Neoplasms;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | respiratory distress syndrome;GAD |
Disease | heart transplant complications;GAD |
Disease | nephritis, Henoch-Schonlein;GAD |
Disease | Familial Mediterranean fever;FunDO |
Disease | Myocardial Infarction;GAD |
Disease | Kidney failure;FunDO |
Disease | giant cell arteritis;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | spontaneous preterm delivery.;GAD |
Disease | RENAL;GAD |
|
External Links |
|
Links to Entrez Gene | 7422 |
Links to all GeneRIF Items | 7422 |
Links to iHOP | 7422 |
|
Sequence Information |
|
Nucleotide Sequence |
>7422 : length: 1239 ctgacggacagacagacagacaccgcccccagccccagctaccacctcctccccggccgg cggcggacagtggacgcggcggcgagccgcgggcaggggccggagcccgcgcccggaggc ggggtggagggggtcggggctcgcggcgtcgcactgaaacttttcgtccaacttctgggc tgttctcgcttcggaggagccgtggtccgcgcgggggaagccgagccgagcggagccgcg agaagtgctagctcgggccgggaggagccgcagccggaggagggggaggaggaagaagag aaggaagaggagagggggccgcagtggcgactcggcgctcggaagccgggctcatggacg ggtgaggcggcggtgtgcgcagacagtgctccagccgcgcgcgctccccaggccctggcc cgggcctcgggccggggaggaagagtagctcgccgaggcgccgaggagagcgggccgccc cacagcccgagccggagagggagcgcgagccgcgccggccccggtcgggcctccgaaacc atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta aacgaacgtacttgcagatgtgacaagccgaggcggtga |
Protein Sequence |
>7422 : length: 412 MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLG CSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWT GEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASET MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |