| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7432 |
Name | VIP |
Synonym | PHM27;vasoactive intestinal peptide;VIP;vasoactive intestinal peptide |
Definition | VIP peptides|prepro-VIP |
Position | 6q25 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | Vasoactive intestinal peptide gene alterations in patients with idiopathic pulmonary arterial hypertension. |
PAH | VIP gene variants related to idiopathic pulmonary arterial hypertension in Chinese population. |
PH | Moderate pulmonary arterial hypertension in male mice lacking the vasoactive intestinal peptide gene. |
PH | Enhancement of pulmonary vascular remodelling and inflammatory genes with VIP gene deletion. |
| More detail of all Human literatures about VIP | |
|
Pathways and Diseases |
|
Pathway | Glucagon-type ligand receptors;PID Reactome;500430 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Disease | Adenocarcinoma;FunDO |
Disease | Dermatitis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Enteritis;FunDO |
Disease | Hypertension;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Pulmonary hypertension;FunDO |
Disease | Polyarthritis;FunDO |
Disease | Cholelithiasis;FunDO |
Disease | Breast cancer;FunDO |
Disease | Arthritis;FunDO |
|
External Links |
|
Links to Entrez Gene | 7432 |
Links to all GeneRIF Items | 7432 |
Links to iHOP | 7432 |
|
Sequence Information |
|
Nucleotide Sequence |
>7432 : length: 513 atggacaccagaaataaggcccagctccttgtgctcctgactcttctcagtgtgctcttc tcacagacttcggcatggcctctttacagggcaccttctgctctcaggttgggtgacaga ataccctttgagggagcaaatgaacctgatcaagtttcattaaaagaagacattgacatg ttgcaaaatgcattagctgaaaatgacacaccctattatgatgtatccagaaatgccagg catgctgatggagttttcaccagtgacttcagtaaactcttgggtcaactttctgccaaa aagtaccttgagtctcttatgggaaaacgtgttagcagtaacatctcagaagaccctgta ccagtcaaacgtcactcagatgcagtcttcactgacaactatacccgccttagaaaacaa atggctgtaaagaaatatttgaactcaattctgaatggaaagaggagcagtgagggagaa tctcccgactttccagaagagttagaaaaatga |
Protein Sequence |
>7432 : length: 170 MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK |