| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 7433 |
Name | VIPR1 |
Synonym | HVR1|II|PACAP-R-2|PACAP-R2|RDC1|V1RG|VAPC1|VIP-R-1|VIPR|VIRG|VPAC1|VPAC1R|VPCAP1R;vasoactive intestinal peptide receptor 1;VIPR1;vasoactive intestinal peptide receptor 1 |
Definition | PACAP type II receptor|VIP and PACAP receptor 1|VIP receptor, type I|pituitary adenylate cyclase activating polypeptide receptor, type II|vasoactive intestinal polypeptide receptor 1 |
Position | 3p22 |
Gene Type | protein-coding |
PAH Type | Description |
PAH | "Pulmonary vascular remodeling and inflammation often coexist in clinical and experimentally induced pulmonary arterial hypertension (PAH). In some instances, the pulmonary hypertension may be the primary, or at least the initial, problem, while inflammatory or autoimmune responses appear to initiate or dominate the picture in other cases. Based on studies in a model of PAH resulting from targeted deletion of the neuropeptide vasoactive intestinal peptide (VIP) gene, we propose that, at least in this experimental model, but possibly also in other situations, both vascular remodeling and inflammation may be mediated by one and the same mechanism: uncontrolled activation of calcineurin-NFAT (nuclear factor of activated T cells) signaling. If this hypothesis is validated, VIP would emerge as an endogenous modulator of pulmonary vascular remodeling and inflammation, through its suppression of NFAT activation." |
PAH | "Pulmonary vascular remodeling and inflammation often coexist in clinical and experimentally induced pulmonary arterial hypertension (PAH). In some instances, the pulmonary hypertension may be the primary, or at least the initial, problem, while inflammatory or autoimmune responses appear to initiate or dominate the picture in other cases. Based on studies in a model of PAH resulting from targeted deletion of the neuropeptide vasoactive intestinal peptide (VIP) gene, we propose that, at least in this experimental model, but possibly also in other situations, both vascular remodeling and inflammation may be mediated by one and the same mechanism: uncontrolled activation of calcineurin-NFAT (nuclear factor of activated T cells) signaling. If this hypothesis is validated, VIP would emerge as an endogenous modulator of pulmonary vascular remodeling and inflammation, through its suppression of NFAT activation." |
| More detail of all Human literatures about VIPR1 | |
Pathways and Diseases | |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Disease | Prostate cancer;FunDO |
Disease | Enteritis;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Rabies;FunDO |
Disease | Yersinia infection;FunDO |
Disease | HIV infection;FunDO |
Disease | Ulcerative colitis;FunDO |
External Links | |
Links to Entrez Gene | 7433 |
Links to all GeneRIF Items | 7433 |
Links to iHOP | 7433 |
Sequence Information | |
Nucleotide Sequence | >7433 : length: 1374 atgcgcccgccaagtccgctgcccgcccgctggctatgcgtgctggcaggcgccctcgcc tgggcccttgggccggcgggcggccaggcggccaggctgcaggaggagtgtgactatgtg cagatgatcgaggtgcagcacaagcagtgcctggaggaggcccagctggagaatgagaca ataggctgcagcaagatgtgggacaacctcacctgctggccagccacccctcggggccag gtagttgtcttggcctgtcccctcatcttcaagctcttctcctccattcaaggccgcaat gtaagccgcagctgcaccgacgaaggctggacgcacctggagcctggcccgtaccccatt gcctgtggtttggatgacaaggcagcgagtttggatgagcagcagaccatgttctacggt tctgtgaagaccggctacaccattggctacggcctgtccctcgccacccttctggtcgcc acagctatcctgagcctgttcaggaagctccactgcacgcggaactacatccacatgcac ctcttcatatccttcatcctgagggctgccgctgtcttcatcaaagacttggccctcttc gacagcggggagtcggaccagtgctccgagggctcggtgggctgtaaggcagccatggtc tttttccaatattgtgtcatggctaacttcttctggctgctggtggagggcctctacctg tacaccctgcttgccgtctccttcttctctgagcggaagtacttctgggggtacatactc atcggctggggggtacccagcacattcaccatggtgtggaccatcgccaggatccatttt gaggattatgggtgctgggacaccatcaactcctcactgtggtggatcataaagggcccc atcctcacctccatcttggtaaacttcatcctgtttatttgcatcatccgaatcctgctt cagaaactgcggcccccagatatcaggaagagtgacagcagtccatactcaaggctagcc aggtccacactcctgctgatccccctgtttggagtacactacatcatgttcgccttcttt ccggacaattttaagcctgaagtgaagatggtctttgagctcgtcgtggggtctttccag ggttttgtggtggctatcctctactgcttcctcaatggtgaggtgcaggcggagctgagg cggaagtggcggcgctggcacctgcagggcgtcctgggctggaaccccaaataccggcac ccgtcgggaggcagcaacggcgccacgtgcagcacgcaggtttccatgctgacccgcgtc agcccaggtgcccgccgctcctccagcttccaagccgaagtctccctggtctga |
Protein Sequence | >7433 : length: 457 MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPI ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH LFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL YTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGP ILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFF PDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV |