| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7494 |
Name | XBP1 |
Synonym | TREB5|XBP-1|XBP2;X-box binding protein 1;XBP1;X-box binding protein 1 |
Definition | X-box-binding protein 1|tax-responsive element-binding protein 5 |
Position | 22q12.1|22q12 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PAH | "Several ER stress/UPR genes, including Immunoglobulin-heavy-chain binding protein (BiP), Activating Transcription Factor-4 and -6 (ATF4 and ATF6) and a spliced form of X-box binding protein (XBP1) were upregulated in lcSSc PBMCs, with the highest levels in patients with PAH. TG upregulated Heat shock proteins (HSP) and Interferon-regulated genes in control PBMCs. Selected HSP genes, particularly DNAJB1, and IFN-related genes were also found at significantly elevated levels in PBMCs from lcSSc patients, while IRF4 was significantly decreased. There was a positive correlation between DNAJB1 and severity of PAH disease (PAP) (r = 0.56, p<0.05) and between ER stress markers and IL-6 levels (r = 0.53, p< 0.0001) in lcSSc PBMCs." |
| More detail of all Human literatures about XBP1 | |
|
Pathways and Diseases |
|
Pathway | Activation of Chaperones by IRE1alpha;PID Reactome;500131 |
Pathway | FOXA1 transcription factor network;PID Curated;200194 |
Pathway | Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141 |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Disease | PSYCH;GAD |
Disease | Myopathy;FunDO |
Disease | Neurotic disorder;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Enteritis;FunDO |
Disease | Encephalopathies;FunDO |
Disease | Multiple myeloma;FunDO |
Disease | schizophrenia;GAD |
Disease | Schizophrenia;FunDO |
Disease | bipolar disorder;GAD |
Disease | Breast cancer;FunDO |
Disease | Bipolar disorder;FunDO |
Disease | Major affective disorder-7, susceptibility to;OMIM |
Disease | Ulcerative colitis;FunDO |
Disease | Diabetes mellitus;FunDO |
|
External Links |
|
Links to Entrez Gene | 7494 |
Links to all GeneRIF Items | 7494 |
Links to iHOP | 7494 |
|
Sequence Information |
|
Nucleotide Sequence |
>7494 : length: 1131 atggtggtggtggcagccgcgccgaacccggccgacgggacccctaaagttctgcttctg tcggggcagcccgcctccgccgccggagccccggccggccaggccctgccgctcatggtg ccagcccagagaggggccagcccggaggcagcgagcggggggctgccccaggcgcgcaag cgacagcgcctcacgcacctgagccccgaggagaaggcgctgaggaggaaactgaaaaac agagtagcagctcagactgccagagatcgaaagaaggctcgaatgagtgagctggaacag caagtggtagatttagaagaagagaaccaaaaacttttgctagaaaatcagcttttacga gagaaaactcatggccttgtagttgagaaccaggagttaagacagcgcttggggatggat gccctggttgctgaagaggaggcggaagccaaggggaatgaagtgaggccagtggccggg tctgctgagtccgcagcaggtgcaggcccagttgtcacccctccagaacatctccccatg gattctggcggtattgactcttcagattcagagtctgatatcctgttgggcattctggac aacttggacccagtcatgttcttcaaatgcccttccccagagcctgccagcctggaggag ctcccagaggtctacccagaaggacccagttccttaccagcctccctttctctgtcagtg gggacgtcatcagccaagctggaagccattaatgaactaattcgttttgaccacatatat accaagcccctagtcttagagataccctctgagacagagagccaagctaatgtggtagtg aaaatcgaggaagcacctctcagcccctcagagaatgatcaccctgaattcattgtctca gtgaaggaagaacctgtagaagatgacctcgttccggagctgggtatctcaaatctgctt tcatccagccactgcccaaagccatcttcctgcctactggatgcttacagtgactgtgga tacgggggttccctttccccattcagtgacatgtcctctctgcttggtgtaaaccattct tgggaggacacttttgccaatgaactctttccccagctgattagtgtctaa |
Protein Sequence |
>7494 : length: 376 MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAGAGPVVTPPEHLPM DSGGIDSSDSESDILLGILDNLDPVMFFKCPSPEPASLEELPEVYPEGPSSLPASLSLSV GTSSAKLEAINELIRFDHIYTKPLVLEIPSETESQANVVVKIEEAPLSPSENDHPEFIVS VKEEPVEDDLVPELGISNLLSSSHCPKPSSCLLDAYSDCGYGGSLSPFSDMSSLLGVNHS WEDTFANELFPQLISV |