| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 79924 |
Name | ADM2 |
Synonym | AM2|dJ579N16.4;adrenomedullin 2;ADM2;adrenomedullin 2 |
Definition | intermedin |
Position | 22q13.33 |
Gene Type | protein-coding |
|
PAH Type |
Description |
HPH | ADM2/IMD might be closely related to chronic hypoxic pulmonary hypertension in rats. |
PH | The level of IMD/ADM2 increases in rats with chronic hypoxia-induced pulmonary hypertension. |
PH | "The expression of IMD/ADM2 peptides in plasma, right ventricular and pulmonary tissues are different in the early-middle pathological stage of pulmonary hypertension induced by two-week hypoxia in rats." |
| More detail of all Rat literatures about ADM2 | |
|
Pathways and Diseases |
|
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Disease | Dermatitis;FunDO |
|
External Links |
|
Links to Entrez Gene | 79924 |
Links to all GeneRIF Items | 79924 |
Links to iHOP | 79924 |
|
Sequence Information |
|
Nucleotide Sequence |
>79924 : length: 447 atggcccggatcccgacggccgccctgggttgcatcagcctcctctgcctgcagctccct ggctcgctgtcccgcagcctgggcggggacccgcgacccgtcaaacccagggagccccca gcccggagcccttccagcagcctgcagcccaggcaccccgcaccccgacctgtggtctgg aagcttcaccgggccctccaggcacagaggggtgccggcctggcccctgttatgggtcag cctctccgggatggtggccgccaacactcgggcccccgaagacactcgggcccccgcagg acccaagcccagctcctgcgagtgggctgtgtgctgggcacctgccaggtgcagaatctc agccaccgcctgtggcaactcatgggaccggccggccggcaggactcagctcctgtggac cccagcagcccccacagctatggctga |
Protein Sequence |
>79924 : length: 148 MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVW KLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNL SHRLWQLMGPAGRQDSAPVDPSSPHSYG |