| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8862 |
Name | APLN |
Synonym | APEL|XNPEP2;apelin;APLN;apelin |
Definition | AGTRL1 ligand|APJ endogenous ligand |
Position | Xq25 |
Gene Type | protein-coding |
|
PAH Type |
Description |
HPH | Physical exercise decreased apelin expression and elevated APJ expression in pulmonary tissues of rats with hypoxic pulmonary hypertension. |
| More detail of all Rat literatures about APLN | |
|
Pathways and Diseases |
|
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Peptide ligand-binding receptors;PID Reactome;500405 |
Disease | Obesity;FunDO |
Disease | Brain tumor;FunDO |
Disease | Breast cancer;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Pre-Eclampsia;FunDO |
|
External Links |
|
Links to Entrez Gene | 8862 |
Links to all GeneRIF Items | 8862 |
Links to iHOP | 8862 |
|
Sequence Information |
|
Nucleotide Sequence |
>8862 : length: 234 atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg tgtggagggtccctgatgccgcttcccgatgggaatgggctggaagacggcaatgtccgc cacctggtgcagcccagagggtcaaggaatgggccagggccctggcagggaggtcggagg aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga |
Protein Sequence |
>8862 : length: 77 MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR KFRRQRPRLSHKGPMPF |