| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8996 |
Name | NOL3 |
Synonym | ARC|FCM|MYP|NOP|NOP30;nucleolar protein 3 (apoptosis repressor with CARD domain);NOL3;nucleolar protein 3 (apoptosis repressor with CARD domain) |
Definition | muscle-enriched cytoplasmic protein|nucleolar protein 3|nucleolar protein of 30 kDa |
Position | 16q22.1 |
Gene Type | protein-coding |
|
PAH Type |
Description |
PH | "ARC, previously unlinked to pulmonary hypertension, is a critical determinant of vascular remodeling in this syndrome." |
PH | "ARC, previously unlinked to pulmonary hypertension, is a critical determinant of vascular remodeling in this syndrome." |
| More detail of all Human literatures about NOL3 | |
|
External Links |
|
Links to Entrez Gene | 8996 |
Links to all GeneRIF Items | 8996 |
Links to iHOP | 8996 |
|
Sequence Information |
|
Nucleotide Sequence |
>8996 : length: 660 atgggcaacgcgcaggagcggccgtcagagactatcgaccgcgagcggaaacgcctggtc gagacgctgcaggcggactcgggactgctgttggacgcgctgctggcgcggggcgtgctc accgggccagagtacgaggcattggatgcactgcctgatgccgagcgcagggtgcgccgc ctactgctgctggtgcagggcaagggcgaggccgcctgccaggagctgctacgctgtgcc cagcgtaccgcgggcgcgccggaccccgcttgggactggcagcacgctaccgggaccgca gctatgaccctccatgcccaggccactggacgccggaggcacccggctcggggaccacat gccccgggttgcccagagcttcagaccctgacgaggccgggggccctgagggctccgagg cggtgcaatccgggaccccggaggagccagagccagagctggaagctgaggcctctaaag aggctgaaccggagccggagccagagccagagctggaacccgaggctgaagcagaaccag agccggaactggagccagaaccggacccagagcccgagcccgacttcgaggaaagggacg agtccgaagattcctgaaggccagagctctgacaggcggtgccccgcccatgctggatag |
Protein Sequence |
>8996 : length: 219 MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR LLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHATGTAAMTLHAQATGRRRHPARGPH APGCPELQTLTRPGALRAPRRCNPGPRRSQSQSWKLRPLKRLNRSRSQSQSWNPRLKQNQ SRNWSQNRTQSPSPTSRKGTSPKIPEGQSSDRRCPAHAG |