| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1031 |
Name | CDKN2C |
Synonym | INK4C|p18|p18-INK4C;cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4);CDKN2C;cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) |
Definition | CDK6 inhibitor p18|cyclin-dependent inhibitor|cyclin-dependent kinase 4 inhibitor C|cyclin-dependent kinase 6 inhibitor p18|p18-INK6 |
Position | 1p32 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 433 |
TUSON P-value | 0.007594678 |
|
Pathways and Diseases |
|
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 1031 |
Links to all GeneRIF Items | 1031 |
Links to iHOP | 1031 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>1031 : length: 507 atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactgctacttagaggt gctaatcccgatttgaaagaccgaactggtttcgctgtcattcatgatgcggccagagca ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccgggtggtggag ttcctggtgaagcacacggccagcaatgtggggcatcggaaccataagggggacaccgcc tgtgatttggccaggctctatgggaggaatgaggttgttagcctgatgcaggcaaacggg gctgggggagccacaaatcttcaataa |
Protein Sequence |
>1031 : length: 168 MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |