| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10550 |
Name | ARL6IP5 |
Synonym | DERP11|GTRAP3-18|HSPC127|JWA|PRAF3|addicsin|hp22|jmx;ADP-ribosylation factor-like 6 interacting protein 5;ARL6IP5;ADP-ribosylation factor-like 6 interacting protein 5 |
Definition | ADP-ribosylation factor-like protein 6-interacting protein 5|ADP-ribosylation-like factor 6 interacting protein 5|ARL-6-interacting protein 5|JM5|PRA1 domain family 3|PRA1 family protein 3|aip-5|cytoskeleton related vitamin A responsive protein|cytoskelet |
Position | 3p14 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 3055 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 10550 |
Links to all GeneRIF Items | 10550 |
Links to iHOP | 10550 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>10550 : length: 567 atggacgttaatatcgccccactccgcgcctgggacgatttcttcccgggttccgatcgc tttgcccggccggacttcagggacatttccaaatggaacaaccgcgtagtgagcaacctg ctctattaccagaccaactacctggtggtggctgccatgatgatttccattgtggggttt ctgagtcccttcaacatgatcctgggaggaatcgtggtggtgctggtgttcacagggttt gtgtgggcagcccacaataaagacgtccttcgccggatgaagaagcgctaccccacgacg ttcgttatggtggtcatgttggcgagctatttccttatctccatgtttggaggagtcatg gtctttgtgtttggcattacttttcctttgctgttgatgtttatccatgcatcgttgaga cttcggaacctcaagaacaaactggagaataaaatggaaggaataggtttgaagaggaca ccgatgggcattgtcctggatgccctagaacagcaggaagaaggcatcaacagactcact gactatatcagcaaagtgaaggaataa |
Protein Sequence |
>10550 : length: 188 MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE |