| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 10904 |
Name | BLCAP |
Synonym | BC10;bladder cancer associated protein;BLCAP;bladder cancer associated protein |
Definition | bladder cancer 10 kDa protein|bladder cancer related protein (10kD)|bladder cancer-associated protein |
Position | 20q11.23 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 3489 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 10904 |
Links to all GeneRIF Items | 10904 |
Links to iHOP | 10904 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>10904 : length: 264 atgtattgcctccagtggctgctgcccgtcctcctcatccccaagcccctcaaccccgcc ctgtggttcagccactccatgttcatgggcttctacctgctcagcttcctcctggaacgg aagccttgcacaatttgtgccttggttttcctggcagccctgttccttatctgctatagc tgctggggaaactgtttcctgtaccactgctccgattccccgcttccagaatcggcgcat gatcccggcgttgtgggcacctaa |
Protein Sequence |
>10904 : length: 87 MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT |