| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 11186 |
Name | RASSF1 |
Synonym | 123F2|NORE2A|RASSF1A|RDA32|REH3P21;Ras association (RalGDS/AF-6) domain family member 1;RASSF1;Ras association (RalGDS/AF-6) domain family member 1 |
Definition | WUGSC:H_LUCA12.5|cardiac-specific ras association domain family 1 protein|pancreas-specific ras association domain family 1 protein|ras association domain-containing protein 1|tumor suppressor protein RDA32 |
Position | 3p21.3 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 13870 |
TUSON P-value | 1 |
| Caution | This gene might be oncogene according to our integrated oncogene list. |
|
Pathways and Diseases |
|
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | p53 pathway;PID Curated;200175 |
Disease | Pre-Eclampsia;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | esophageal cancer;GAD |
Disease | Non-small cell lung cancer;KEGG DISEASE;H00014 |
Disease | Lung cancer;OMIM |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | breast cancer;GAD |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | Infection;FunDO |
Disease | head and neck cancer;GAD |
Disease | Obesity;FunDO |
Disease | Nasopharyngeal cancer;KEGG DISEASE;H00054 |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | lung cancer;GAD |
Disease | Head and neck cancers;KEGG DISEASE |
Disease | Bladder cancer;KEGG DISEASE;H00022 |
Disease | colorectal cancer;GAD |
|
External Links |
|
Links to Entrez Gene | 11186 |
Links to all GeneRIF Items | 11186 |
Links to iHOP | 11186 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>11186 : length: 1023 atgtcgggggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg aagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc aaccccacacggcagctggtccctggccgtggccaccgcttccagcccgcggggcccgcc acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaaaggcctg cagtgcgcgcattgcaagttcacctgccactaccgctgccgcgcgctcgtctgcctggac tgttgcgggccccgggacctgggctgggaacccgcggtggagcgggacacgaacgtggac gagcctgtggagtgggagacacctgacctttctcaagctgagattgagcagaagatcaag gagtacaatgcccagatcaacagcaacctcttcatgagcttgaacaaggacggttcttac acaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtgccctccagcaag aagccaccctccttgcaggatgcccggcggggcccaggacggggcacaagtgtcaggcgc cgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtgctgtcacgcaca agggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtggatgacccccgc aagtttgcactctttgagcgcgctgagcgtcacggccaagtgtacttgcggaagctgttg gatgatgagcagcccctgcggctgcggctcctggcagggcccagtgacaaggccctgagc tttgtcctgaaggaaaatgactctggggaggtgaactgggacgccttcagcatgcctgaa ctacataacttcctacgtatcctgcagcgggaggaggaggagcacctccgccagatcctg cagaagtactcctattgccgccagaagatccaagaggccctgcacgcctgcccccttggg tga |
Protein Sequence |
>11186 : length: 340 MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVD EPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK KPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR KFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPE LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG |