| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 116173 |
Name | CMTM5 |
Synonym | CKLFSF5;CKLF-like MARVEL transmembrane domain containing 5;CMTM5;CKLF-like MARVEL transmembrane domain containing 5 |
Definition | CKLF-like MARVEL transmembrane domain-containing protein 5|chemokine-like factor super family 5|chemokine-like factor superfamily member 5 |
Position | 14q11.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5117 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 116173 |
Links to all GeneRIF Items | 116173 |
Links to iHOP | 116173 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>116173 : length: 378 atgctcagtgctcgagatcgccgggaccggcaccctgaggagggggtagttgcagagctc cagggcttcgcggtggacaaggccttcctcacctcccacaagggcatcctgctggaaacc gagctggccctgaccctcatcatcttcatctgcttcacggcctccatctctgcctacatg gccgcggcgctactggagttcttcatcacacttgccttcctcttcctctatgccacccag tactaccagcgcttcgaccgaattaactggccctgtctggtttttggcatcatcctggtt tccatctttgcctatgatgccttcaagatctaccggactgagatggcacccggggccagc cagggggaccagcagtga |
Protein Sequence |
>116173 : length: 125 MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM AAALLEFFITLAFLFLYATQYYQRFDRINWPCLVFGIILVSIFAYDAFKIYRTEMAPGAS QGDQQ |