| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1672 |
Name | DEFB1 |
Synonym | BD1|DEFB-1|DEFB101|HBD1;defensin, beta 1;DEFB1;defensin, beta 1 |
Definition | BD-1|beta defensin 1|beta-defensin 1|beta-defensin-1 |
Position | 8p23.1 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 5842 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 1672 |
Links to all GeneRIF Items | 1672 |
Links to iHOP | 1672 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>1672 : length: 207 atgagaacttcctaccttctgctgtttactctctgcttacttttgtctgagatggcctca ggtggtaactttctcacaggccttggccacagatctgatcattacaattgcgtcagcagt ggagggcaatgtctctattctgcctgcccgatctttaccaaaattcaaggcacctgttac agagggaaggccaagtgctgcaagtga |
Protein Sequence |
>1672 : length: 68 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY RGKAKCCK |