| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 171023 |
Name | ASXL1 |
Synonym | BOPS|MDS;additional sex combs like transcriptional regulator 1;ASXL1;additional sex combs like transcriptional regulator 1 |
Definition | additional sex combs like 1|putative Polycomb group protein ASXL1 |
Position | 20q11 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 63 |
TUSON P-value | 3.27E-08 |
|
External Links |
|
Links to Entrez Gene | 171023 |
Links to all GeneRIF Items | 171023 |
Links to iHOP | 171023 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>171023 : length: 258 atgaaggacaaacagaagaagaagaaggagcgcacgtgggccgaggccgcgcgcctggta ttagaaaactactcggatgctccaatgacaccaaaacagattctgcaggtcatagaggca gaaggactaaaggaaatgagaagtgggacttcccctctcgcatgcctcaatgctatgcta cattccaattcaagaggaggagaggggttgttttataaactgcctggccgaatcagcctt ttcacgctcaaggtgtga |
Protein Sequence |
>171023 : length: 85 MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAML HSNSRGGEGLFYKLPGRISLFTLKV |