| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 2170 |
Name | FABP3 |
Synonym | FABP11|H-FABP|M-FABP|MDGI|O-FABP;fatty acid binding protein 3, muscle and heart;FABP3;fatty acid binding protein 3, muscle and heart |
Definition | Fatty acid-binding protein 3, muscle|fatty acid binding protein 11|fatty acid-binding protein, heart|heart-type fatty acid-binding protein|mammary-derived growth inhibitor|muscle fatty acid-binding protein |
Position | 1p33-p32 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 6753 |
TUSON P-value | 1 |
|
Pathways and Diseases |
|
Pathway | PPAR signaling pathway;KEGG PATHWAY;hsa03320 |
Disease | Heart failure;FunDO |
Disease | Down syndrome;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Lung cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 2170 |
Links to all GeneRIF Items | 2170 |
Links to iHOP | 2170 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>2170 : length: 402 atggtggacgctttcctgggcacctggaagctagtggacagcaagaatttcgatgactac atgaagtcactcggtgtgggttttgctaccaggcaggtggccagcatgaccaagcctacc acaatcatcgaaaagaatggggacattctcaccctaaaaacacacagcaccttcaagaac acagagatcagctttaagttgggggtggagttcgatgagacaacagcagatgacaggaag gtcaagtccattgtgacactggatggagggaaacttgttcacctgcagaaatgggacggg caagagaccacacttgtgcgggagctaattgatggaaaactcatcctgacactcacccac ggcactgcagtttgcactcgcacttatgagaaagaggcatga |
Protein Sequence |
>2170 : length: 133 MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH GTAVCTRTYEKEA |