| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 23261 |
Name | CAMTA1 |
Synonym | CANPMR;calmodulin binding transcription activator 1;CAMTA1;calmodulin binding transcription activator 1 |
Definition | calmodulin-binding transcription activator 1 |
Position | 1p36.31-p36.23 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 4215 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 23261 |
Links to all GeneRIF Items | 23261 |
Links to iHOP | 23261 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>23261 : length: 243 atgtggcgcgcggaggggaaatggctgccgaaaacaagccggaagagcgtttcccaaagt gtattctgcggaactagcacctactgtgttctcaacaccgtgccacctatagaagatgat catgggaacagcaatagtagtcatgtaaaaatctttttaccgaaaaagctgcttgaatgt ctgccgaaatgttcaagtttaccaaaagagaggcaccgctggaacactaatgagagatca tga |
Protein Sequence |
>23261 : length: 80 MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLEC LPKCSSLPKERHRWNTNERS |