| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 26471 |
Name | NUPR1 |
Synonym | COM1|P8;nuclear protein, transcriptional regulator, 1;NUPR1;nuclear protein, transcriptional regulator, 1 |
Definition | candidate of metastasis 1|nuclear protein 1|protein p8 |
Position | 16p11.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 11699 |
TUSON P-value | 1 |
|
External Links |
|
Links to Entrez Gene | 26471 |
Links to all GeneRIF Items | 26471 |
Links to iHOP | 26471 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>26471 : length: 303 atggccaccttcccaccagcaaccagcgccccccagcagcccccaggcccggaggacgag gactccagcctggatgaatctgacctctatagcctggcccattcctacctcgggcctctc atcatgcctatgcccacttcacctctgactcctgccttggttacaggaggtggaggccgg aaaggtcgcaccaagagagaagctgctgccaacaccaaccgccccagccctggcgggcac gagaggaaactggtgaccaagctgcagaattcagagaggaagaagcgaggggcacggcgc tga |
Protein Sequence |
>26471 : length: 100 MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGPLIMPMPTSPLTPALVTGGGGR KGRTKREAAANTNRPSPGGHERKLVTKLQNSERKKRGARR |